KEGG   Ursus maritimus (polar bear): 103680825
Entry
103680825         CDS       T03271                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04010  MAPK signaling pathway
umr05200  Pathways in cancer
umr05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103680825 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103680825 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    103680825 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:umr03000]
    103680825 (MECOM)
Transcription factors [BR:umr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    103680825 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-met Zn-ribbon_8 zf-C2H2_11 zf-BED
Other DBs
NCBI-GeneID: 103680825
NCBI-ProteinID: XP_008708530
UniProt: A0A384DP20
Position
Un
AA seq 1235 aa
MRSKGRARKLATSNECVYGSYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDKFELRESSMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDPSYGWE
ILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEEL
LLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEED
FQQKLESENDLRDIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSN
LIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQ
HKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRR
FCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAP
GFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQDILKAL
SKHPPVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDI
ESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAI
ASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQ
SPNEVKKLQKGSSESPFDLTTKRKDEKPLTPGPSKPPATPVTSQDQPLDLSMGSRSRASG
TKLTEPRKNHVFGEKKGSSIEPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKE
KYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAP
PNALPENLGPRTAGFPQTCEYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNL
QRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAIL
DDKEDAYFTEIRNFIGNSNHSSQSPRNTEERMNGSHFKDEKALVTSQNSDLLDDEEVEEE
VLLDEEDDDNDITGKTGKEPGTSNLHEGNPEDDYEEASALEMSCKASPVRYKEEEYKTGL
SALDHIRHFTDSLKMRKLEDNQYSEAELSSFSASHVPEELKQPLHRKSKSQAYAMMLSLS
DKESLHSTSHSSSNVWHTMARAAAESSAIQSVSHV
NT seq 3708 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgtatatggcagc
taccctgaaattcctttggaagaaatgccagatgcagatggagtagccagcactccctcc
ctcaatattcaagagccatgctctccagccacatccagcgaagctttcactccaaaggag
ggctctccatacaaagcccccatctacatccctgatgataaatttgaacttcgagagtca
agtatgcctggagcaggactaggaatatggaccaaaaggaagattgaagctggtgaaaag
tttgggccgtatgtgggagagcagaggtcaaacctgaaagaccccagctatggatgggag
atcttagatgagttttgcaatgtgaagttctgcatagatgctagtcaaccagatgtagga
agctggctcaagtacatcaggttcgctggctgttacgatcaacacaacctcgttgcatgc
cagataaatgaccagatattttacagagtagtagcagacattgccccaggagaggagctc
ctgctgttcatgaagagtgaagactatccccatgaaactatggcgccggatatccacgaa
gaacggcaatatcgctgcgaggactgtgaccagctctttgagtccaaggctgagctagca
gatcaccagaagttcccctgcagtacccctcactcagcattttcaatggtggaagaagac
ttccaacaaaaacttgaaagcgaaaacgatctccgagacatacatgcaatccaggagtgt
aaggaatgtgaccaagttttccccgatttgcaaagcctggagaaacacatgttgtcacat
actgaagagagggaatacaagtgcgatcagtgtcccaaggcatttaactggaagtccaat
ctaattcgccaccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgcc
aaggttttcacggaccctagcaaccttcagcggcacatccgctctcagcatgttggtgcc
cgggcccacgcgtgcccggagtgtggcaaaacgtttgccacttcgtcgggcctcaaacaa
cacaagcacatccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctat
actcagttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatc
aagtgcaaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagg
ttttgtgagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcactt
cctggaacccccgctatggataaaacgtccatggttaatatgagtcatgccaacccgggc
cttgctgactattttggtgccaataggcatcccgctggtcttacctttccaacagctcct
ggattttcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttg
atacctgctagctctcctgttaaaggactatcaagtactgaacagacaaacaaaagtcaa
agtcccctcatgacacatcctcagatactgccagctacacaggatattttgaaagcacta
tctaaacacccacctgtaggagacaataagccagtggagctccagcccgagaggtcctct
gaagagaggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtc
agtacgccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacatt
gaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccct
cttcagaatctggcttcaatacataataagaaagaatacagcaatcattccattttctca
ccatctttagaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggctatt
gcttctattgctgaaaaatactttggttcaacaggactggtggggctgcaagacaaaaaa
gttggagctttaccttacccttccatgtttcccctcccattttttccagcattctctcaa
tcaatgtacccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaa
tcaccaaacgaagtaaagaaactgcagaagggaagctctgagtctccctttgatctcacc
actaagcgaaaggacgagaagcccttgactccaggaccctccaagcctccagcaacacct
gtcacaagccaagaccagcccctggatctaagtatgggcagtaggagtagagccagtgga
acgaagctgactgagccccgtaaaaaccacgtgtttggggaaaagaaaggaagcagtatt
gaaccaagacccgcatcggacggttccttgcagcacgctagacccactcctttctttatg
gacccaatttacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagag
aaatacttgagaccttctccaggattcttatttcacccacaattccaactgcctgatcag
agaacttggatgtcagctattgaaaacatggcagagaagttagagagcttcagtgccctg
aaaccggaggccagcgaacttctgcagtcagttccctccatgttcaacttcagagcacct
cccaatgccttgccggagaacctagggcccaggacagccggctttccccaaacatgtgaa
tactgtggcaagatttttccaaggtctgcgaacttaacacggcacttgagaacccacaca
ggagagcaaccttacagatgcaaatactgtgacagatcctttagcatctcctccaacttg
cagaggcatgtccggaacatccacaataaggagaagccctttaagtgtcacttatgtgat
aggtgttttggtcaacaaaccaacttagacagacacctaaagaaacatgagaatgggaac
atgtctggtacggcaacgtcgtcgcctcattccgaactggagagcacaggcgcgattctc
gatgacaaagaagatgcttacttcacagaaatccgcaatttcattgggaacagcaaccac
agcagccaatctcccaggaacacagaggagaggatgaacggcagtcattttaaggatgag
aaagctttggtgaccagccaaaattcagatttactggatgatgaagaagtagaagaggag
gtgttgttagatgaggaggacgatgacaacgacattactggaaaaacgggaaaagagcca
gggacaagcaatttacatgaaggaaaccctgaggatgactatgaagaagccagcgccctg
gagatgagttgcaaagcgtccccagtgaggtataaagaggaagaatataaaactggactt
tctgctctagatcatataaggcacttcacagatagcctcaaaatgaggaaactggaagat
aatcaatattctgaagctgagctgtcttcttttagtgcttcccatgtgccggaggaactt
aaacagccgttacacagaaagtccaaatcacaggcatatgctatgatgttgtcactgtcc
gacaaggagtccctccattctacatcccacagttcttccaacgtgtggcacactatggca
agggctgcggcggaatccagtgccatccagtccgtaagccacgtatga

DBGET integrated database retrieval system