KEGG   Viruses: 1403460Help
Entry
1403460           CDS       T40000                                 

Gene name
POLY, HGvBgp1
Definition
(RefSeq) Hepatitis GB virus B; polyprotein
Taxonomy
TAX:39113
  Lineage
Viruses; ssRNA viruses; Flaviviridae; Hepacivirus
Taxonomy
Organism
vg  Viruses (Hepatitis GB virus B)
SSDB OrthologParalogGFIT
Motif
Pfam: RdRP_3 HCV_NS4b Peptidase_S29 HCV_NS5a_1b HCV_env HCV_NS5a_1a HCV_NS4a HCV_NS5a Flavi_DEAD HCV_core HCV_NS2 Trypsin_2 ResIII Uteroglobin
Motif
Other DBs
NCBI-GeneID: 1403460
NCBI-ProteinID: NP_056931
RS: NC_001655
UniProt: Q69422
Structure
PDB: 

Position
NC_001655:446..9040
AA seq 2864 aa AA seqDB search
MPVISTQTSPVPAPRTRKNKQTQASYPVSIKTSVERGQRAKRKVQRDARPRNYKIAGIHD
GLQTLAQAALPAHGWGRQDPRHKSRNLGILLDYPLGWIGDVTTHTPLVGPLVAGAVVRPV
CQIVRLLEDGVNWATGWFGVHLFVVCLLSLACPCSGARVTDPDTNTTILTNCCQRNQVIY
CSPSTCLHEPGCVICADECWVPANPYISHPSNWTGTDSFLADHIDFVMGALVTCDALDIG
ELCGACVLVGDWLVRHWLIHIDLNETGTCYLEVPTGIDPGFLGFIGWMAGKVEAVIFLTK
LASQVPYAIATMFSSVHYLAVGALIYYASRGKWYQLLLALMLYIEATSGNPIRVPTGCSI
AEFCSPLMIPCPCHSYLSENVSEVICYSPKWTRPITLEYNNSISWYPYTIPGARGCMVKF
KNNTWGCCRIRNVPSYCTMGTDAVWNDTRNTYEACGVTPWLTTAWHNGSALKLAILQYPG
SKEMFKPHNWMSGHLYFEGSDTPIVYFYDPVNSTLLPPERWARLPGTPPVVRGSWLQVPQ
GFYSDVKDLATGLITKDKAWKNYQVLYSATGALSLTGVTTKAVVLILLGLCGSKYLILAY
LCYLSLCFGRASGYPLRPVLPSQSYLQAGWDVLSKAQVAPFALIFFICCYLRCRLRYAAL
LGFVPMAAGLPLTFFVAAAAAQPDYDWWVRLLVAGLVLWAGRNRGHRIALLVGPWPLVAL
LTLLHLVTPASAFDTEIIGGLTIPPVVALVVMSRFGFFAHLLPRCALVNSYLWQRWENWF
WNVTLRPERFFLVLVCFPGATYDALVTFCVCHVALLCLTSSAASFFGTDSRVRAHRMLVR
LGKCHAWYSHYVLKFFLLVFGENGVFFYKHLHGDVLPNDFASKLPLQEPFFPFEGKARVY
RNEGRRLACGDTVDGLPVVARLGDLVFAGLAMPPDGWAITAPFTLQCLSERGTLSAMAVV
MTGIDPRTWTGTIFRLGSLATSYMGFVCDNVLYTAHHGSKGRRLAHPTGSIHPITVDAAN
DQDIYQPPCGAGSLTRCSCGETKGYLVTRLGSLVEVNKSDDPYWCVCGALPMAVAKGSSG
APILCSSGHVIGMFTAARNSGGSVSQIRVRPLVCAGYHPQYTAHATLDTKPTVPNEYSVQ
ILIAPTGSGKSTKLPLSYMQEKYEVLVLNPSVATTASMPKYMHATYGVNPNCYFNGKCTN
TGASLTYSTYGMYLTGACSRNYDVIICDECHATDATTVLGIGKVLTEAPSKNVRLVVLAT
ATPPGVIPTPHANITEIQLTDEGTIPFHGKKIKEENLKKGRHLIFEATKKHCDELANELA
RKGITAVSYYRGCDISKIPEGDCVVVATDALCTGYTGDFDSVYDCSLMVEGTCHVDLDPT
FTMGVRVCGVSAIVKGQRRGRTGRGRAGIYYYVDGSCTPSGMVPECNIVEAFDAAKAWYG
LSSTEAQTILDTYRTQPGLPAIGANLDEWADLFSMVNPEPSFVNTAKRTADNYVLLTAAQ
LQLCHQYGYAAPNDAPRWQGARLGKKPCGVLWRLDGADACPGPEPSEVTRYQMCFTEVNT
SGTAALAVGVGVAMAYLAIDTFGATCVRRCWSITSVPTGATVAPVVDEEEIVEECASFIP
LEAMVAAIDKLKSTITTTSPFTLETALEKLNTFLGPHAATILAIIEYCCGLVTLPDNPFA
SCVFAFIAGITTPLPHKIKMFLSLFGGAIASKLTDARGALAFMMAGAAGTALGTWTSVGF
VFDMLGGYAAASSTACLTFKCLMGEWPTMDQLAGLVYSAFNPAAGVVGVLSACAMFALTT
AGPDHWPNRLLTMLARSNTVCNEYFIATRDIRRKILGILEASTPWSVISACIRWLHTPTE
DDCGLIAWGLEIWQYVCNFFVICFNVLKAGVQSMVNIPGCPFYSCQKGYKGPWIGSGMLQ
ARCPCGAELIFSVENGFAKLYKGPRTCSNYWRGAVPVNARLCGSARPDPTDWTSLVVNYG
VRDYCKYEKMGDHIFVTAVSSPNVCFTQVPPTLRAAVAVDGVQVQCYLGEPKTPWTTSAC
CYGPDGKGKTVKLPFRVDGHTPGVRMQLNLRDALETNDCNSTNNTPSDEAAVSALVFKQE
LRRTNQLLEAISAGVDTTKLPAPSIEEVVVRKRQFRARTGSLTLPPPPRSVPGVSCPESL
QRSDPLEGPSNLPPSPPVLQLAMPMPLLGAGECNPFTAIGCAMTETGGGPDDLPSYPPKK
EVSEWSDESWSTATTASSYVTGPPYPKIRGKDSTQSAPAKRPTKKKLGKSEFSCSMSYTW
TDVISFKTASKVLSATRAITSGFLKQRSLVYVTEPRDAELRKQKVTINRQPLFPPSYHKQ
VRLAKEKASKVVGVMWDYDEVAAHTPSKSAKSHITGLRGTDVRSGAARKAVLDLQKCVEA
GEIPSHYRQTVIVPKEEVFVKTPQKPTKKPPRLISYPHLEMRCVEKMYYGQVAPDVVKAV
MGDAYGFVDPRTRVKRLLSMWSPDAVGATCDTVCFDSTITPEDIMVETDIYSAAKLSDQH
RAGIHTIARQLYAGGPMIAYDGREIGYRRCRSSGVYTTSSSNSLTCWLKVNAAAEQAGMK
NPRFLICGDDCTVIWKSAGADADKQAMRVFASWMKVMGAPQDCVPQPKYSLEELTSCSSN
VTSGITKSGKPYYFLTRDPRIPLGRCSAEGLGYNPSAAWIGYLIHHYPCLWVSRVLAVHF
MEQMLFEDKLPETVTFDWYGKNYTVPVEDLPSIIAGVHGIEAFSVVRYTNAEILRVSQSL
TDMTMPPLRAWRKKARAVLASAKRRGGAHAKLARFLLWHATSRPLPDLDKTSVARYTTFN
YCDVYSPEGDVFITPQRRLQKFLVKYLAVIVFALGLIAVGLAIS
NT seq 8595 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttatttctactcaaacaagtcctgtacctgcgcccagaacgcgcaagaacaag
cagacgcaggcttcatatcctgtgtccattaaaacatctgttgaaaggggacaacgagca
aagcgcaaagtccagcgcgatgctcggcctcgtaattacaaaattgctggtatccatgat
ggcttgcagacattggctcaggctgctttgccagctcatggttggggacgccaagaccct
cgccataagtctcgcaatcttggaatccttctggattaccctttggggtggattggtgat
gttacaactcacacacctctagtaggcccgctggtggcaggagcggtcgttcgaccagtc
tgccagatagtacgcttgctggaggatggagtcaactgggctactggttggttcggtgtc
cacctttttgtggtatgtctgctatctttggcctgtccctgtagtggggcgcgggtcact
gacccagacacaaataccacaatcctgaccaattgctgccagcgtaatcaggttatctat
tgttctccttccacttgcctacacgagcctggttgtgtgatctgtgcggacgagtgctgg
gttcccgccaatccgtacatctcacacccttccaattggactggcacggactccttcttg
gctgaccacattgattttgttatgggcgctcttgtgacctgtgacgcccttgacattggt
gagttgtgtggtgcgtgtgtattagtcggtgactggcttgtcaggcactggcttattcac
atagacctcaatgaaactggtacttgttacctggaagtgcccactggaatagatcctggg
ttcctagggtttatcgggtggatggccggcaaggtcgaggctgtcatcttcttgaccaaa
ctggcttcacaagtaccatacgctattgcgactatgtttagcagtgtacactacctggcg
gttggcgctctgatctactatgcctctcggggcaagtggtatcagttgctcctagcgctt
atgctttacatagaagcgacctctggaaaccccatcagggtgcccactggatgctcaata
gctgagttttgctcgcctttgatgataccatgtccttgccactcttatttgagtgagaat
gtgtcagaagtcatttgttacagtccaaagtggaccaggcctatcactctagagtataac
aactccatatcttggtacccctatacaatccctggtgcgaggggatgtatggttaaattc
aaaaataacacatggggttgctgccgtattcgcaatgtgccatcgtactgcactatgggc
actgatgcagtgtggaacgacactcgcaacacttacgaagcatgcggtgtaacaccatgg
ctaacaaccgcatggcacaacggctcagccctgaaattggctatattacaataccctggg
tctaaagaaatgtttaaacctcataattggatgtcaggccatttgtattttgagggatca
gatacccctatagtttacttttatgaccctgtgaattccactctcctaccaccggagagg
tgggctaggttgcccggtaccccacctgtggtacgtggttcttggttacaggttccgcaa
gggttttacagtgatgtgaaagacctagccacaggattgatcaccaaagacaaagcctgg
aaaaattatcaggtcttatattccgccacgggtgctttgtctcttacgggagttaccacc
aaggccgtggtgctaattctgttggggttgtgtggcagcaagtatcttattttagcctac
ctctgttacttgtccctttgttttgggcgcgcttctggttaccctttgcgtcctgtgctc
ccatcccagtcgtatctccaagctggctgggatgttttgtctaaagctcaagtagctcct
tttgctttgattttcttcatctgttgctatctccgctgcaggctacgttatgctgccctt
ttagggtttgtgcccatggctgcgggcttgcccctaactttctttgttgcagcagctgct
gcccaaccagattatgactggtgggtgcgactgctagtggcagggttagttttgtgggcc
ggccgtaaccgtggtcaccgcatagctctgcttgtaggtccttggcctctggtagcgctt
ttaaccctcttgcatttggttacgcctgcttcagcttttgataccgagataattggaggg
ctgacaataccacctgtagtagcattagttgtcatgtctcgttttggcttctttgctcac
ttgttacctcgctgtgctttagttaactcctatctttggcaacgttgggagaattggttt
tggaacgttacactaagaccggagaggtttttccttgtgctggtttgtttccccggtgcg
acatatgacgcgctggtgactttctgtgtgtgtcacgtagctcttctatgtttaacatcc
agtgcagcatcgttctttgggactgactctagggttagggcccatagaatgttggtgcgt
ctcggaaagtgtcatgcttggtattctcattatgttcttaagtttttcctcttagtgttt
ggtgagaatggtgtgtttttctataagcacttgcatggtgatgtcttgcctaatgatttt
gcctcgaaactaccattgcaagagccatttttcccttttgaaggcaaggcaagggtctat
aggaatgaaggaagacgcttggcgtgtggggacacggttgatggtttgcccgttgttgcg
cgtctcggcgaccttgttttcgcagggttggctatgccgccagatgggtgggccattacc
gcaccttttacgctgcagtgtctctctgaacgtggcacgctgtcagcgatggcagtggtc
atgactggtatagacccccgaacttggactggaactatcttcagattaggatctctggcc
actagctacatgggatttgtttgtgacaacgtgttgtatactgctcaccatggcagcaag
gggcgccggttggctcatcccacaggctctatacacccaataaccgttgacgcggctaat
gaccaggacatctatcaaccaccatgtggagctgggtcccttactcggtgctcttgcggg
gagaccaaggggtatctggtaacacgactggggtcattggttgaggtcaacaaatccgat
gacccttattggtgtgtgtgcggggcccttcccatggctgttgccaagggttcttcaggt
gccccgattctgtgctcctccgggcatgttattgggatgttcaccgctgctagaaattct
ggcggttcagtcagtcagattagggttaggccgttggtgtgtgctggataccatccccag
tacacagcacatgccactcttgatacaaaacctactgtgcctaacgagtattcagtgcaa
attttaattgcccccactggcagcggcaagtcaaccaaattaccactttcttacatgcag
gagaagtatgaggtcttggtcctaaatcccagtgtggctacaacagcatcaatgccaaag
tacatgcacgcgacgtacggcgtgaatccaaattgctattttaatggcaaatgtaccaac
acaggggcttcacttacgtacagcacatatggcatgtacctgaccggagcatgttcccgg
aactatgatgtaatcatttgtgacgaatgccatgctaccgatgcaaccaccgtgttgggc
attggaaaggtcctaaccgaagctccatccaaaaatgttaggctagtggttcttgccacg
gctaccccccctggagtaatccctacaccacatgccaacataactgagattcaattaacc
gatgaaggcactatcccctttcatggaaaaaagattaaggaggaaaatctgaagaaaggg
agacaccttatctttgaggctaccaaaaaacactgtgatgagcttgctaacgagttagct
cgaaagggaataacagctgtctcttactataggggatgtgacatctcaaaaatccctgag
ggcgactgtgtagtagttgccactgatgccttgtgtacagggtacactggtgactttgat
tccgtgtatgactgcagcctcatggtagaaggcacatgccatgttgaccttgaccctact
ttcaccatgggtgttcgtgtgtgcggggtttcagcaatagttaaaggccagcgtaggggc
cgcacaggccgtgggagagctggcatatactactatgtagacgggagttgtaccccttcg
ggtatggttcctgaatgcaacattgttgaagccttcgacgcagccaaggcatggtatggt
ttgtcatcaacagaagctcaaactattctggacacctatcgcacccaacctgggttacct
gcgataggagcaaatttggacgagtgggctgatctcttttctatggtcaaccccgaacct
tcatttgtcaatactgcaaaaagaactgctgacaattatgttttgttgactgcagcccaa
ctacaactgtgtcatcagtatggctatgctgctcccaatgacgcaccacggtggcaggga
gcccggcttgggaaaaaaccttgtggggttctgtggcgcttggacggcgctgacgcctgt
cctggcccagagcccagcgaggtgaccagataccaaatgtgcttcactgaagtcaatact
tctgggacagccgcactcgctgttggcgttggagtggctatggcttatctagccattgac
acttttggcgccacttgtgtgcggcgttgctggtctattacatcagtccctaccggtgct
actgtcgccccagtggttgacgaagaagaaatcgtggaggagtgtgcatcattcattccc
ttggaggccatggttgctgcaattgacaagctgaagagtacaatcaccacaactagtcct
ttcacattggaaaccgcccttgaaaaacttaacacctttcttgggcctcatgcagctaca
atccttgctatcatagagtattgctgtggtttagtcactttacctgacaatccctttgca
tcatgcgtgtttgctttcattgcgggtattactaccccactacctcacaagatcaaaatg
ttcctgtcattatttggaggcgcaattgcgtccaagcttacagacgctagaggcgcactg
gcgttcatgatggccggggctgcgggaacagctcttggtacatggacatcggtgggtttt
gtctttgacatgctaggcggctatgctgccgcctcatccactgcttgcttgacatttaaa
tgcttgatgggtgagtggcccactatggatcagcttgctggtttagtctactccgcgttc
aatccggccgcaggagttgtgggcgtcttgtcagcttgtgcaatgtttgctttgacaaca
gcagggccagatcactggcccaacagacttcttactatgcttgctaggagcaacactgta
tgtaatgagtactttattgccactcgtgacatccgcaggaagatactgggcattctggag
gcatctaccccctggagtgtcatatcagcttgcatccgttggctccacaccccgacggag
gatgattgcggcctcattgcttggggtctagagatttggcagtatgtgtgcaatttcttt
gtgatttgctttaatgtccttaaagctggagttcagagcatggttaacattcctggttgt
cctttctacagctgccagaaggggtacaagggcccctggattggatcaggtatgctccaa
gcacgctgtccatgcggtgctgaactcatcttttctgttgagaatggttttgcaaaactt
tacaaaggacccagaacttgttcaaattactggagaggggctgttccagtcaacgctagg
ctgtgtgggtcggctagaccggacccaactgattggactagtcttgtcgtcaattatggc
gttagggactactgtaaatatgagaaaatgggagatcacatttttgttacagcagtatcc
tctccaaatgtctgtttcacccaggtgcccccaaccttgagagctgcagtggccgtggac
ggcgtacaggttcagtgttatctaggtgagcccaaaactccttggacgacatctgcttgc
tgttacggtcctgacggtaagggtaaaactgttaagcttcccttccgcgttgacggtcac
acacctggtgtgcgcatgcaacttaatttgcgtgatgcacttgagacaaatgactgtaat
tccacaaacaacactcctagtgatgaagccgcagtgtccgctcttgttttcaaacaggag
ttgcggcgtacaaaccaattgcttgaggcaatttcagctggcgttgacaccaccaaactg
ccagccccctccatcgaagaggtagtggtaagaaagcgccagttccgggcaagaactggt
tcgcttaccttgcctccccctccgagatccgtcccaggagtgtcatgtcctgaaagcctg
caacgaagtgacccgttagaaggtccttcaaacctccctccttcaccacctgttctacag
ttggccatgccgatgcccctgttgggagcgggtgagtgtaaccctttcactgcaattgga
tgtgcaatgaccgaaacaggcggaggccctgatgatttacccagttaccctcccaaaaag
gaggtctctgaatggtcagacgaaagttggtcgacggctacaaccgcttccagctacgtt
actggccccccgtaccctaagatacggggaaaggattccactcagtcagcccccgccaaa
cggcctacaaaaaagaagttgggaaagagtgagttttcgtgcagcatgagctacacctgg
accgacgtgattagcttcaaaactgcttctaaagttctgtctgcaactcgggccatcact
agtggtttcctcaaacaaagatcattggtgtatgtgactgagccgcgggatgcggagctt
agaaaacaaaaagtcactattaatagacaacctctgttccccccatcataccacaagcaa
gtgagattggctaaggaaaaagcttcaaaagttgtcggtgtcatgtgggactatgatgaa
gtagcagctcacacgccctctaagtctgctaagtcccacatcactggccttcggggcact
gatgttcgttctggagcagcccgcaaggctgttctggacttgcagaagtgtgtcgaggca
ggtgagataccgagtcattatcggcaaactgtgatagttccaaaggaggaggtcttcgtg
aagaccccccagaaaccaacaaagaaacccccaaggcttatctcgtacccccaccttgaa
atgagatgtgttgagaagatgtactacggtcaggttgctcctgacgtagttaaagctgtc
atgggagatgcgtacgggtttgtagatccacgtacccgtgtcaagcgtctgttgtcgatg
tggtcacccgatgcagtcggagccacatgcgatacagtgtgttttgacagtaccatcaca
cccgaggatatcatggtggagacagacatctactcagcagctaaactcagtgaccaacac
cgagctggcattcacaccattgcgaggcagttatacgctggaggaccgatgatcgcttat
gatggccgagagatcggatatcgtaggtgtaggtcttccggcgtctatactacctcaagt
tccaacagtttgacctgctggctgaaggtaaatgctgcagccgaacaggctggcatgaag
aaccctcgcttccttatttgcggcgatgattgcaccgtaatttggaagagcgccggagca
gatgcagacaaacaagcaatgcgtgtctttgctagctggatgaaggtgatgggtgcacca
caagattgtgtgcctcaacccaaatacagtttggaagaattaacatcatgctcatcaaat
gttacctctggaattaccaaaagtggcaagccttactactttcttacaagagatcctcgt
atcccccttggcaggtgctctgccgagggtctgggatacaaccccagtgctgcgtggatt
gggtatctaatacatcactacccatgtttgtgggttagccgtgtgttggctgtccatttc
atggagcagatgctctttgaggacaaacttcccgagactgtgacctttgactggtatggg
aaaaattatacggtgcctgtagaagatctgcccagcatcattgctggtgtgcacggtatt
gaggctttctcggtggtgcgctacaccaacgctgagatcctcagagtttcccaatcacta
acagacatgaccatgccccccctgcgagcctggcgaaagaaagccagggcggtcctcgcc
agcgccaagaggcgtggcggagcacacgcaaaattggctcgcttccttctctggcatgct
acatctagacctctaccagatttggataagacgagcgtggctcggtacaccactttcaat
tattgtgatgtttactccccggagggggatgtgtttattacaccacagagaagattgcag
aagttccttgtgaagtatttggctgtcattgtttttgccctagggctcattgctgttgga
ttagccatcagctga

DBGET integrated database retrieval system