KEGG   Vitis vinifera (wine grape): 100257000
Entry
100257000         CDS       T01084                                 

Name
(RefSeq) probable E3 ubiquitin-protein ligase ARI8
  KO
K11968  ariadne-1 [EC:2.3.2.31]
Organism
vvi  Vitis vinifera (wine grape)
Brite
KEGG Orthology (KO) [BR:vvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvi04121]
    100257000
Enzymes [BR:vvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     100257000
Ubiquitin system [BR:vvi04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    100257000
SSDB
Motif
Pfam: IBR Ariadne zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-C3HC4 zf-RING_UBOX ZapD DUF6210
Other DBs
NCBI-GeneID: 100257000
NCBI-ProteinID: XP_002268068
Position
Un
AA seq 652 aa
MNSNVFICSQLLIHFLIFIFFRQISPECAEELWPLHLAINYRFAIGSSIFFLLPLLRPNF
LQKKKMESEDDMHDANDAESLDDFYSGETAADSDDLDAADYEFIDNDSDDSDDLTSHRYQ
QNYTILTEADIRQRQEDDITRISTVLSIPRVSASILLRHYYWSVSKVHDEWFADEEKVRK
AVGLLEKPVVQFPNARELTCGICFENYPRDRISSAACGHPFCGTCWAGYTSTAITDGPGC
LMLRCPDPTCGAAVGQDMINLLASDEDKEKYSRYFLRSYIEDNRKTKWCPAPGCDYAVDF
IVGSGSYDVSCRCSYSFCWNCTEEAHRPVDCGTVAKWILKNSAESENMNWILANSKPCPK
CKRPIEKNQGCMHITCTPPCKFEFCWLCLGAWSDHGERTGGFYACNRYETAKQEGVYDEA
EKRRDMAKNSLERYTHYYERWATNQSSRQKALADLQQMQTVNIEKLSDKQCQPESQLKFI
TEAWLQIVECRRVLKWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCAEKELQTY
LDADGPSKDFNEFRTKLAGLTSVTRNYFENLVRALENGLSDVDSRGACSRTASSKSLGGG
SSKARGGRGKGTSSRSSSSSRNLDDSGHWSCEHCTFANVRSATICQICQQRR
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgaattcaaatgtatttatatgttctcaacttcttattcatttcttaatctttattttt
tttaggcaaatttctcctgaatgtgctgaagaattatggcccctccacttggcgattaat
taccgctttgccatcggctcctccattttctttctccttcctcttctgcgccctaatttt
ttgcagaagaagaagatggagtcggaggacgatatgcacgacgccaacgatgccgagtcc
ctcgacgacttctacagcggcgagactgccgccgacagcgacgacctcgacgctgccgac
tacgagttcatcgacaacgactccgatgactccgatgacctcacctcccaccgctaccag
caaaactataccattttgactgaagcagatattcgtcaacgtcaagaggatgatattaca
aggatatccactgtcctctctataccaagggtttcagctagcatccttctccgccactat
tattggagtgtcagtaaagtgcatgatgaatggtttgcagatgaagagaaggtccgaaag
gctgttggcttgttagagaaaccagtcgttcaattccctaatgctagagagctgacttgt
gggatatgttttgaaaactatcctcgtgataggataagttctgctgcttgtggtcaccct
ttctgtggtacatgctgggcaggttatactagtacagcaattactgatggtcctggatgt
ttgatgttgcgctgtcctgatccaacctgtggtgctgctgttggtcaggacatgataaat
ttattggcttctgatgaagacaaagagaagtattctcgttactttcttagatcttatatt
gaagacaataggaagaccaaatggtgtcccgctccaggctgtgattatgcagttgatttt
attgttggtagtggaagctatgacgtttcctgccgctgctcatatagcttttgctggaat
tgtacagaggaagctcaccgtcctgttgattgcggcactgtggccaagtggattttgaag
aatagtgctgagtctgagaacatgaattggatattggctaattccaagccttgtccaaag
tgtaagcggccaatcgaaaaaaaccaaggttgtatgcatatcacatgcacaccgccatgt
aaatttgagttttgctggctttgtcttggtgcatggtcagatcatggtgagaggacaggt
ggtttttatgcatgtaaccgttatgagacagcaaagcaagagggagtgtatgatgaggct
gagaaacgaagggatatggctaagaactctttggagagatatactcattattatgaacga
tgggcgaccaaccaatcttctaggcagaaagcacttgcagacctacagcagatgcaaact
gtaaatattgagaagctgagtgataagcagtgccagcccgagtcacaactcaagttcata
acagaggcctggttgcagatagttgaatgtaggcgagttctaaaatggacatatgcctat
ggatattatttacctgagcatgaacatgctaagagacagttctttgagtacttgcaaggt
gaggctgagtctggcctggaacgacttcatcaatgtgcagagaaggagctacaaacatat
ctcgatgcagatggcccatcaaaagacttcaatgagttccgcacaaagctagctgggcta
accagtgtgacgcgaaattactttgagaatctggtccgagctctggagaatggtctgtca
gatgtggattcccgtggtgcctgcagcaggactgcaagttctaaaagtttgggaggtggg
agcagcaaggcaagaggtgggaggggcaagggaacatcatcccgatcaagtagttccagt
agaaaccttgatgattcaggccattggtcttgtgaacattgcacttttgccaatgtcagg
tccgccactatttgccagatttgccagcaacggcggtaa

DBGET integrated database retrieval system