KEGG   Xanthomonas citri pv. citri 306: XAC2259
Entry
XAC2259           CDS       T00084                                 
Name
(GenBank) conserved hypothetical protein
Organism
xac  Xanthomonas citri pv. citri 306
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB AAA_16 AAA_22
Other DBs
NCBI-ProteinID: AAM37112
UniProt: Q8PKB6
Position
2640736..2642433
AA seq 565 aa
MRPLPPVGGLPHLHGIEPEEMDVTLPLGERVGHTLVLGTTRVGKTRLAELFITQDIRRRA
ADGGHEVVIVFDPKGDADLLKRMYVEARRAGRESEFYVFHLGWPDLSAHYNAIGRFGRIS
EVATRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYLLIQRHVINIDALFMEY
AAQFFAKTEPKAWEVIVQLEGRLNDKNIPRNMIGREKRVIAIEQYLSQVRVYDPVLDGLR
SAVRYDRTYFDKIVASLLPLLEKLTTGKVAQLLAPNYSDLADPRPIFDWMQIIRKRAIVY
VGLDALSDAEVAAAVGNSMFSDLVSVAGHIYKFGVDDGLPGANANSKVPINVHADEFNEL
MGDEFIPMVNKGGGAGVQVTAYTQTLSDIEARIGNRAKAGQVVGNFNNLVMLRVRETATA
ELLTRQLPKVEVFATSVMSGATDSSDPTGNTAFTSNTQDRIASTSVLMIEPAHVVALPKG
QAFALMEGGNLWKVRMPLPAPDPDEAMPRDLQELAAGMRLHYVEAGAWWDGQIAPGLQDA
TLPDDLLAGFAPPEDAGGNPGAAAP
NT seq 1698 nt   +upstreamnt  +downstreamnt
gtgcgccccttgccacccgtgggcggcctgccccatctgcacggcatcgagcccgaagag
atggacgtcaccctgccgctgggcgaacgggtcggccacacgctggtgctcggcaccacg
cgggtcggcaagacccggctggccgaactgttcatcacgcaggacatccgccgccgcgcg
gcggatggcgggcacgaggtggtgatcgtgttcgatccgaagggggatgcggacctgctc
aagcggatgtacgtggaagcacgccgcgcgggacgcgagagcgagttctacgtgttccat
ctgggctggccggacctgagcgcgcactacaacgccatcggccgcttcggccgcatctcc
gaagtcgccacccgcatcgcggggcaactgtccggggaaggcaacagcgccgctttccgt
gagttcgcgtggcggttcgtcaacatcatcgcccgcgcgctcgtggaactggggcagcga
ccggactacctgctgatccagcggcacgtcatcaacatcgatgcgctgttcatggagtat
gcggcgcagttcttcgcgaagaccgaacccaaggcctgggaggtcatcgtccagctcgaa
ggccggctcaacgacaagaacatcccgcgcaacatgatcggccgcgagaagcgcgtgatc
gcgatcgagcagtacctctcgcaggtccgcgtctacgacccggtgctcgacggcctgcga
agcgccgtgcgctacgaccggacgtacttcgacaagatcgtcgcgagcctgctgccgctg
ctggagaagctcaccacgggcaaggtcgcccagttgctggcgccgaattactcggacctc
gccgatccgcggccgatcttcgactggatgcagatcatccgcaaacgcgcgatcgtgtac
gtgggactggacgcgctctcagatgcggaggtggcggccgccgtgggcaactcgatgttc
tcggacctggtctcggtcgcggggcacatctacaagttcggcgtggacgacggcctgccg
ggtgcgaatgcgaattccaaggtgcccatcaacgtccatgccgacgagttcaacgagctc
atgggcgatgaattcattcccatggtcaacaagggcggcggtgccggcgtccaggtcacg
gcgtacacccagacgctctccgatatcgaggcgcgcatcggcaatcgcgcgaaggcggga
caggtcgtggggaatttcaacaacctggtcatgctgcgggtgcgagagacggccacggcc
gagctgctgacgcgccagttgcccaaggtcgaggtgttcgcgacctcggtgatgagcggc
gccacggacagctccgatcccacgggcaacaccgcgtttacctcgaacacccaggaccgc
atcgccagtaccagcgtgctgatgatcgagcccgcgcacgtagtggcgttgccgaagggc
caggccttcgcgctgatggaaggtggcaacctctggaaggtgcgcatgccgctgcccgcg
cccgatcccgacgaggccatgccgcgcgatctgcaggagctcgctgccggcatgcggttg
cactacgtcgaggcgggcgcatggtgggatggacagatcgcgccagggctgcaggacgca
accttgcccgacgatctactggcaggtttcgcgccgccggaggacgcaggcggaaaccct
ggagctgcggcgccatga

DBGET integrated database retrieval system