KEGG   Xenopus tropicalis (western clawed frog): 100496511
Entry
100496511         CDS       T01011                                 

Gene name
mecom
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100496511 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    100496511 (mecom)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    100496511 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-C2H2_11 PyrI_C zf-met RGS12_us1
Other DBs
NCBI-GeneID: 100496511
NCBI-ProteinID: XP_031758134
Position
5
AA seq 1057 aa
MKSEDYTYARMAPDIHEERQYRCEECDQLFESKTELSDHQKYPCGTPHSAFSLVENSFPA
SLNDDSDLGEMQHTHECKECDQVFPDMQSLEKHLLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDTGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSECGKTFATSSGLKQHK
HIHSSVKPFVCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGLFGQGISLPGTPAMDKASMIGINHANAGLADYFGASRHTAGLTFPTAPGF
PFSFPGLFPSSLYHRPPLIPAASPVKGLPSVEQSRKSQSPHVNQPQVLPATQDILKALSK
HPSIDGNKALEFISDSNVNQRPHEKVSDHSESSDLDDVSTPSGSDLETTSGSDLESDIES
DKEKLKENGKLFKGKISPLQSLAALNSKREYNNHSVFSPCLEEQTAVTGAVNDSIKAIAS
IAEKYFGSTGLVGLPDKKGTSLPYPSMFPLPFFPAFSQSMYTFPDRDVRPVTLKVEPESP
KETKKVQKGTAESPFDLTTKRKEEKASPNAPSKSGAPTSSNHDQPLDLSISSRSRASTTK
QTEARKNHIFGEKKDIDPELPKTSDHCLQHPRPAPFFMDPIYRYRVEKRKQLDPLELLKE
KYLRPSPGFLFHPQFPLPDQRTWMSAIENMAEKLESFNALKPEANELIQSVPSMFNFRPS
SSALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQ
RHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNLSGTAASSPHSEIEGTGAILD
DKEDSYFNEIRNFIGNSGHNKQSPLNSDERINGNHDKIMLTGQNSDLLDDDEIEDEAILD
EDDEESDIAVKVMKEPNASAMLEKCSADEYEEGSKSEVNCKVSPSRYDDDDDDEEEDFKT
SLSALDHIRHFTDSLKMRKMDDGQFNDGELSAFTASHLTDDLKHPLYRKSKSQAYAMMLS
LSDQESLHPTTHTSSSMWHNLARAAAESTALHSVSHV
NT seq 3174 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattatacctatgcaagaatggctccagatatccatgaggaacgccag
tatcgctgtgaagagtgtgatcaactgtttgaatccaaaacagagctgagtgatcaccag
aaatacccctgtggtacaccccactcagccttttcactagtggagaacagctttcctgca
agcctaaatgatgacagtgacctcggagagatgcagcacacccatgagtgcaaagaatgt
gatcaagtctttccagacatgcaaagcctggaaaagcacttgctgtcccatacagaggag
agagagtacaaatgtgatcagtgtcccaaggcttttaactggaagtccaaccttattcgt
catcagatgtcacatgatacgggaaagcactatgaatgcgagaactgttccaagcaggtt
ttcacggatcctagcaacctccaaaggcacattaggtcccagcatgttggagcccgtgca
catgcttgctctgagtgcggaaaaacctttgctacatcatcaggtctcaaacaacacaag
cacatccacagcagtgtcaagccctttgtatgtgaagtctgccataagtcatatactcag
ttttccaatctctgtcggcataagcgcatgcacgctgactgcaggactcagatcaaatgc
aaagactgtggccaaatgttcagcaccacatcatcacttaataagcacaggaggttttgc
gaggggaaaaatcattttgctgcaggaggattgtttgggcaaggcatttctcttcctgga
accccagccatggacaaagcttctatgattggtataaaccatgcaaatgctgggcttgcg
gactattttggtgctagtcggcatactgctggtcttacattcccaacagctcctggattt
cctttcagttttcctggtctgtttccatcaagtctttaccacagaccccctttgatacct
gctgcttctccggtgaaagggcttccaagtgttgaacagagcagaaagagtcagagtccc
catgttaaccagcctcaggtattaccagctacacaggacattttaaaagcactaagtaag
cacccatctatagatggaaataaggctctggagttcatatcagacagtaatgtgaaccag
aggcctcatgaaaaggtaagcgaccattcagagagtagtgaccttgatgatgtcagtact
ccgagtgggagtgacttggagacaacctctggttctgaccttgaaagcgacattgaaagt
gataaagaaaaactaaaagaaaatgggaaactatttaaaggcaaaattagccctttacaa
agcctagctgcactaaatagtaaaagggaatacaataatcattctgttttttcaccatgc
ttagaggaacagactgccgtcacaggggcagtgaacgactctattaaagctattgcttcc
attgctgagaagtactttggttcaacaggactggtagggttgccagataaaaaaggcact
tcattaccttacccttctatgtttccccttccatttttccctgctttctctcagtcaatg
tatacattccctgacagagatgtaagaccagtaactttaaaagtggaaccagaatctcca
aaagaaactaagaaagtgcaaaaggggacagctgaatctccctttgatcttactaccaaa
cggaaagaggaaaaggctagcccaaatgccccctcaaaatctggtgctcctacatcttca
aaccatgatcagcctttggatttaagcataagcagcagaagtcgagcctctaccacaaaa
cagacagaagccagaaaaaatcatatctttggtgagaaaaaagacattgacccagagctt
ccaaagacatctgatcactgcttacaacatccaagacctgcaccattcttcatggatcct
atttacaggtaccgggtagaaaaaagaaaacaattggatcctctggaattgctaaaggaa
aaatatttaaggccgtctccagggttcttatttcacccgcagttccctctgccagaccag
cgaacttggatgtcagcaatagaaaacatggcggaaaaactggagagtttcaatgccctt
aaaccagaagccaatgaacttatacagtctgttccttctatgtttaatttccgaccctct
tcaagtgccctacctgagaatcttcttcggaagggaaaagagcgctatacctgcaggtac
tgtgggaagatttttccaagatctgcaaaccttactcggcatctacggactcacactgga
gagcagccttatcgatgcaaatactgtgatcgttcctttagtatatcttcaaacttgcaa
aggcacgtccgcaacatccacaacaaggaaaaaccatttaaatgtcacctgtgcgacaga
tgttttggccaacaaaccaacttggacaggcatttaaaaaagcatgagaatggaaactta
tctggtactgctgcatcttctccccattcagaaatagaaggcacaggtgcaatcttagat
gacaaagaggattcttactttaatgaaatacgaaattttatagggaacagcggccacaat
aagcagtcccctttaaattccgatgaaagaataaatggcaaccacgacaaaattatgctc
actggtcagaattcagacttattggatgatgatgaaatagaagatgaagcaatccttgat
gaagatgatgaagaaagtgacattgctgtaaaagtgatgaaggaacccaatgcaagtgcc
atgcttgaaaaatgttctgctgatgaatatgaagaaggaagtaaatctgaagtgaactgc
aaagtttcacccagcaggtatgatgatgacgatgatgatgaagaagaagatttcaagaca
agtctctctgcattggatcatataaggcacttcacagacagtctcaaaatgcggaaaatg
gatgacggacagtttaatgatggggaactctctgctttcactgcttctcatctgacagat
gacctaaagcatccattgtacagaaaatctaaatcacaggcatatgcaatgatgctgtct
ctgtctgatcaggaatccctccatcctactactcatacttcctccagcatgtggcacaac
ttagccagagcagctgccgaatccactgcactccactccgtgagtcacgtatga

DBGET integrated database retrieval system