KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3705
Entry
YpsIP31758_3705   CDS       T00570                                 
Name
(GenBank) conserved hypothetical protein
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE HerA_C T2SSE AAA_29 DUF87 AAA_7
Other DBs
NCBI-ProteinID: ABS46131
UniProt: A0A0U1QUK9
Position
complement(4182460..4185306)
AA seq 948 aa
MFSLFRPKAASPDIHLNDDGPFAVAGREPCSREGKFTHSDEAKSYGTEPSIIDYMPWGEY
LREERCLLLDDGLSVGAVFEVIPVGTEGRSTERLEEIRDVVEDALQDSLPELNDHQWVVQ
FYCQDETDVTAYMDKLRSYVKPWAQGTPFTQAWLAETENHMKSISVEKGLFEDKVVTGAP
WRGQTRRTRMVIYRYVEKRGHELRSPAVMLNQVCDRLTSALAGAGIRCERQNGEQIHSWL
LRWFNPKPEWVAPNVLYRTARYDDGAPDSLPILNDFSETLWFTRPRSDAERGVWWFDNMA
HKAVPVERLRRAPQTGHLTGEVKRGENINTLMDLMPEGTMIAMTLIVQPQDVLEEEFNRL
GRNAMGENIESTRVREDEHSAREYLGERHKLYRATLTFLIKASDLDILDKRYLDISAKLL
NAGLQPVNPEHDVAPLNGYLRALPMCFNPDADKNHWYTRLTFVQHFACLLPVFGRDTGTG
HPGFSFFNRGGAPLTFDPLNKDDRTQNAHLLLFGPTGSGKSATLCSSLSQLMAVHRPRLF
LLEAGNSFGLFADYCSSLGLTVNKISVKPGKGVSLAPFADAHLLLQASPDEWVTDEAELS
DIDTTDDNDDKRDILGEMEIAARLMVTGGEAAEEARMTRADRGMLREAILAAARTSFEAG
RQMLPEDLMRELENIARDNHTDENGRERRTAGRRARAEEMSQALRMFTGGFEGELFNRPG
APWPEADVTLIDLGTLAREGYEAQMAVAVIALVNTVNNIAERDQYLDREINMVIDEAHIV
TTNPLLSPYMTKVVKMWRKLGAWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQ
ISRFKKLTEEQKTMLLSATKLPRCYTEGVVLAKRVEALFRAVPPSLYLALGMTEKEEKAE
RRQLMTEHNCSELEAAFHVARKLDRARGMTAKEKSPKTGVDCSNPLGR
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgttttcattatttcgccctaaagcggcctcacccgatattcatttgaacgatgatggc
ccttttgctgttgcgggacgtgaaccgtgcagtcgggaagggaagtttacccatagcgat
gaagcaaaatcgtatggcaccgaaccgtcgattattgattatatgccttggggggaatat
ctccgggaagagcgttgtttgttactggatgatggcttgtcggtcggcgcagtttttgaa
gtgatcccggtcggaacggaagggcgctcaactgaacggcttgaggagatccgagacgtt
gtggaagatgcattgcaggacagtttacctgagctgaatgaccaccaatgggtggtgcag
ttttattgtcaggatgagacggatgtcacggcgtacatggataagctgcgtagctatgtg
aaaccttgggcacagggcacgccgtttacacaggcctggctggccgaaacagaaaaccac
atgaaaagcatctcagtggaaaaaggcctgtttgaggataaggttgtcacgggtgcgcca
tggcgcggtcagacgcgccgcacgcggatggtgatttaccgctatgttgaaaaacgtggg
catgaactgcggtcaccagcagtaatgctaaatcaagtttgtgatcgcctgacctctgcg
ttagccggtgcaggtatccgctgtgagcgacaaaatggggagcaaattcatagctggttg
ttgcgctggtttaatcctaaacctgaatgggttgcaccgaatgtactttaccgtactgcc
cggtacgatgacggcgcgccggactctttgccgattctgaatgatttcagcgaaaccctg
tggtttacccgcccacgtagtgacgctgaacgcggcgtatggtggtttgataacatggcg
cataaagcggtgccggtagagcgactgcgccgtgctcctcagacggggcatctgactggc
gaagtcaagcgcggtgaaaatatcaatacattgatggatctgatgccggaaggcaccatg
attgccatgacgttaattgtgcaaccgcaagatgtgctggaagaggagtttaaccgcctt
ggccgcaacgcgatgggggaaaatattgaatcgactcgcgtccgtgaagatgaacatagc
gcccgtgaatatctgggcgaacggcataaattgtaccgagccacgctgacgttcctgatc
aaagcatcggatctggatattctggacaaacgttatctcgatattagcgccaaactgctt
aatgccgggttacagccggtcaatcctgagcacgacgtagcgccacttaacggctatttg
cgggcattgcccatgtgttttaaccccgatgcggataaaaatcattggtacactcggcta
accttcgtgcagcattttgcctgcctgctgccggtatttgggcgggacaccggcaccggt
catccggggttttcgttcttcaatcgtggcggtgcgccgctaacttttgatccactcaac
aaagacgaccgcacgcagaatgcccatttgttgttgttcgggccaaccggctcaggaaaa
tcagccacgctgtgcagttcgttgtctcaactgatggcggttcaccgtccacgtctgttt
ctactggaagccggtaactcttttggcctgtttgccgactattgcagctcgttggggctg
acggtcaataaaattagcgttaaacccggtaaaggggtttcattggctccgtttgccgat
gcacatctgctattgcaggcctctcccgatgaatgggtcacggatgaagcagaattatcc
gatattgatacaaccgacgacaacgatgataaacgcgatattctcggtgaaatggagatt
gccgctcgcctgatggttaccggcggtgaagcggctgaagaggctcgcatgacgcgggct
gatcgggggatgttgcgcgaagccattctggccgcagcacgtacttcctttgaggcgggg
cgtcaaatgttgccggaggatttaatgcgtgagctggaaaatattgctcgtgacaaccat
acagatgaaaacggacgtgagcgcagaaccgccggtcggcgggccagggcagaagagatg
tcgcaagcgctgcgaatgtttaccggaggatttgaaggtgagctgttcaaccgccctgga
gcgccctggccagaagccgatgtcacgcttattgacctcggcacccttgctcgcgaaggc
tacgaagcacagatggcggtcgccgttatcgctctggtaaacactgtcaataacatcgca
gaacgtgatcagtatctcgatcgggaaatcaatatggtcattgatgaagctcatattgtg
accactaacccgctgttatcgccttatatgaccaaggtcgtaaaaatgtggcgcaagctc
ggtgcctggttgtggctggcaacacagaatttggctgattaccctgataccgcagaaaaa
atgctgaacatggcggagtggtggctgtgtctgacgatgccaccagatgaggtcgaacag
atttcccgcttcaaaaaactcaccgaggagcaaaaaaccatgttgttatcggcaacaaaa
ctccccagatgctacacggagggtgtggtgttggccaaacgtgtcgaggctttattcagg
gcggtaccgcccagcctttatttagcgctgggaatgacggagaaagaagaaaaagcagag
cgccgtcagttaatgactgagcataattgcagtgaactggaagcggcattccatgtggcg
cgaaagctggatagggcgcggggtatgacagcaaaagaaaagtcacccaaaacgggggtt
gactgctcaaatcctttgggcagataa

DBGET integrated database retrieval system