KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3718Help
Entry
YpsIP31758_3718   CDS       T00570                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87
Motif
Other DBs
NCBI-ProteinID: ABS48313
UniProt: A0A0U1QZS0
Position
complement(4195489..4197609)
Genome map
AA seq 706 aa AA seqDB search
MSDKYVMESLLRPAVELYTAATAWSAVYICLTAPWAVALAPSVSWVTAAGFSVFALKRTH
QGLRILRYRRNIRRLPRYAMSSRHIPISHRYLFLGRGFQWTQKHTQRLLEARHPETEHYV
QPSVIYRMARDLEKRLESRLPWLCRLTQADTGLNPVRPLPPVGGSPIYHGVELNERDVLY
DLGDRVGHTLVIGTTRVGKTRLAEVLVTQDIRRGDVTVMFDPKGDADLLKRMWAETRRAG
RENEFYVFHLGWPDISARYNAIGRFSRISEVASRVAGQLSGEGNSAAFREFAWRFVNIIT
RALVALGQRPDYGLILRYVTNIGELYETYVENLLTVQAPQLWLNVQNVISSNMLKERDLP
RNMQGQANAMKVWAIETVLSSDAGKKLWDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKL
TTGKTAALLAPDYNDMKDTRPIFDWQEVIRKKGIVYVGLDALSDPEVASAVGNSMFADLV
SVAGHIYKFGISDEIGAKTQKKVPINLHCDEFNELMGDEFIPLINKGGGAGIQVTAYTQT
LSDIEARVGSSAKAKQVVGNFNSLIMLRVRENSTAELLTSQLPEVDVYTKTLVSGVTDMA
NPEQDSDFTSNVQDRVSSIRMPMVTPADIINLPKGQAFALLEGGQLWKVRMPLPDGSNDP
LMPESISRIVEYMQQNYRTGENWWLGSALPSDILAASDFSQGDAEN
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataaatatgtgatggaatccctgttgcgtcccgccgtcgaattgtacacggca
gccacggcgtggagcgccgtttacatttgcctgacggcaccctgggcggtggcattggca
ccgtctgttagttgggtgacggcggcgggctttagtgtttttgctttgaaacgaacccac
caagggctgcgtattctgcgctaccggcgcaacatccggcggctgccccgttatgcaatg
agtagccgacacatccccattagtcaccgatatctgtttctggggcgcgggtttcagtgg
acacaaaaacacacgcagcggctgctggaagcgcgtcatccagagaccgaacattatgtg
cagccatcggttatctatcgtatggctcgggatttggagaaacgtctggaatcccgcttg
ccatggttgtgtcggctgacgcaggccgatacgggtttaaatccggtaagaccgctgccg
cccgtcgggggcagcccaatctatcacggtgttgaattaaatgaacgtgacgttctgtat
gacttgggagaccgtgtcggccacacgctggttatcggaaccacccgcgtggggaaaact
cgtttagcagaggtgctggtcacgcaagatattcgtcgcggggacgtgaccgtcatgttc
gatcctaaaggggatgccgatctgcttaaacgtatgtgggcggaaacgcgtagagcgggg
agggagaatgagttttacgtattccatctgggctggccagatatcagcgcccgttacaac
gccataggtcgcttcagccgtatctctgaagtcgcttcacgcgtggccgggcaattatcc
ggtgaaggtaattcagccgcgtttcgtgaattcgcctggcgctttgtgaacatcattacc
cgcgcattagtcgcccttgggcagcgccctgattacgggctcatcctgcgttatgtgacc
aatattggcgaactttatgagacttatgtagaaaacctgctgacagtacaagcccctcag
ctctggctgaatgttcagaacgtgatcagttcgaacatgctgaaagagcgtgatcttccc
cgaaatatgcagggccaggccaatgccatgaaagtgtgggcgatcgagacggtactcagc
agtgatgccggcaagaaattgtgggatccagtgctggatggtctacgcagtgcggttcgt
tatgatcgtacctattttgacaagatcgtggcttcgttactgccactgttggaaaagctc
actaccggtaaaaccgcggctctgctggcacctgattacaatgatatgaaagatacgcgg
ccaatttttgactggcaggaagtgatccgtaaaaaggggattgtgtatgtcggtctcgat
gcactgtctgatcctgaagtggcgtcggcggtgggcaacagtatgtttgctgatctggtc
tcagttgcgggccatatctacaaatttggcatcagtgatgaaattggcgctaaaacgcag
aagaaagtgccgattaacctgcattgcgacgagttcaacgagttgatgggggatgagttc
atcccattaattaacaaagggggcggggcaggtatccaggtgacggcgtacactcagacg
ctttcagacattgaagcgcgagtgggcagtagtgctaaagcgaagcaggttgttggtaat
ttcaactccctgattatgctaagggtacgtgaaaacagcaccgccgaactgctgaccagc
caactgccggaagttgatgtttatactaaaacgctggtctctggcgtaacggatatggct
aaccctgagcaggattctgatttcaccagtaatgtacaagaccgtgtgagtagcatccgt
atgcccatggtcacgccagcagatattatcaacctgcccaaaggtcaggcgtttgcactg
ctcgaaggtgggcaactgtggaaggtcagaatgcctcttcctgatggtagcaatgatccg
ttgatgccggaaagtatcagccggatagtcgaatacatgcagcagaattaccgtactggg
gaaaattggtggttggggagtgcgctaccgtccgatattttggccgcgtcagattttagt
caaggggacgctgaaaattaa

DBGET integrated database retrieval system