KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3669
Entry
y3669             CDS       T00092                                 

Definition
(GenBank) putative ATP-dependent protease
  KO
K11907  type VI secretion system protein VasG
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ypk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    y3669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ypk02044]
    y3669
Secretion system [BR:ypk02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   y3669
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_16 AAA_5 Clp_N AAA_22 Sigma54_activat Zeta_toxin AAA_7 NACHT ResIII T2SSE ClpB_D2-small Torsin AAA_30 AAA_18 Lipase_chap TniB DUF87 AAA_25 RuvB_N DUF815 RsgA_GTPase ATPase_2 TrwB_AAD_bind IstB_IS21 Muted SseB_C FlxA
Other DBs
NCBI-ProteinID: AAM87217
UniProt: A0A0H2W9K7
Position
complement(4076150..4078753)
AA seq 867 aa
MGAITVYQRERLFNRLGTFAYKTFVEATRLCRSYRHEYVELEHWLKILMDQQRGDIPALL
THYGLSQTVISTQLDRIIQHMPVTKASVQDLSSRLESVVEGGLVLSQLMASPSPIRTSHI
LLALLQDTQHQRWLYRLCDEFKKLPVPQVAEEYEGLLVNSIEQTSEVQRGDALVTETDSS
SSKEAHAALNKWCNDLTQQARDGEIDPVIGREAELRQVIDILLRRRQNNPILVGEAGVGK
TAVVEALARKLASGDVPPLLQGARLLSLDLGRMQAGASMRGEFESRLKSLIDGISQSDTP
VILFCDEAHTLVGAGGQAGTGDAVNLLKPMLARGALRMIAATTWSEYKQFIEPDAALTRR
FQRVLIGEPNESTAVDMLRAIAPHFAQHHNVTIRDGAIHAAVRLSLRNLPSRQLPDKAIS
LLDTACARVALSQYAQPQAIEQLSAQLDVLKTEHQYLVREKQLGEAVDQRLDDVQTQIQA
FEHELTALQSRHLHEQQLVREVLPEGEGSGMMTENARWGELMALQEASPLVYPWVDEQSI
AAVLSDWTGIPSGKMLQDDIECVLNLEQRLGDHIFGQRNAIKEISQAIRIARAGIQSQER
PLGIFLLAGSTGTGKTETANVLVETLYGGAHNLITFNMSEFQEAHTLSTLKGAPPGYVGY
GKGGKLTEAVRRKPYSVILLDEFDKAHADIQDAFYQVFDKGWMEDAEGRRVSFRQCFILL
TCNQGAEEIEQAYLTANDIKPGALKPLVYDALLRRFAPALLARVNIIPYIPLDQDALAQI
ASHHLARLQTRLWDEIGATLVTEGDIPGWIASRVCSHPNHGRAVEELLRQTLLPAVGNEV
LKRRHEAEPLREIRLIVEETELSIEFA
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgggagcgataacggtgtatcaacgcgaacgtctttttaatcgattgggcacttttgcc
tataaaacttttgttgaagccacccgtctttgccgcagttatcggcatgagtatgtggag
cttgaacattggttaaaaattctcatggatcaacagcgtggggatattcctgctctactg
acgcattacggactgagccagacggttatctccacgcaattggatcgcattattcagcat
atgcccgtcaccaaagcatcggtgcaggatttatcatcacgcttggagtccgtggtcgaa
ggcggattggtgttgagccaattgatggcgtcaccttctcctatccgtacctcgcatatt
ttactggcactattacaggatacccagcatcagcgctggttataccgcctgtgcgatgaa
ttcaaaaagctgccggtcccacaggttgcagaggaatatgaaggcctattagttaactcc
attgaacagaccagcgaggttcaaagaggcgacgcattagtgacggaaacggacagcagc
tcatcaaaagaagcgcatgcggcattgaacaaatggtgtaacgaccttacccagcaagcc
cgtgacggtgagattgaccccgttattggtcgtgaagcagaactgcgtcaagtgattgat
attttactccgtcgccgtcagaacaaccctattttggttggggaagcgggggtcggtaaa
acggcggtggttgaagcgctagcgcgaaaactggccagtggcgatgtccctccgctgttg
caaggggcgcgtctgctttctctggatttggggaggatgcaagccggtgccagtatgcgc
ggtgaatttgaatcacgtcttaaatccctgatcgatggcatcagccaatcggataccccg
gttattctgttttgtgatgaagcccatacgttggtgggggcaggcgggcaggcgggcacg
ggggatgcggtcaacctgcttaaaccgatgttggcgaggggcgcattgcgcatgatcgcc
gccaccacctggtcagagtataaacagtttattgaacctgacgccgcgctgacccggcgt
ttccagcgggtattgattggcgagccaaacgaatctaccgccgtcgatatgctacgggcg
attgcgccacattttgctcaacatcataacgtcactatccgcgacggtgccattcacgcg
gcggtgcgcctgtcattacgcaacctgccttcccggcagttgcccgataaagccatcagt
ctgctcgacaccgcttgcgcgcgggtcgcgctcagccaatatgcccaaccacaggcgatt
gaacagttatcggcccaactggatgtgctcaaaaccgagcatcaatatctggtacgggag
aagcaactgggcgaagcggttgatcaacggctagatgacgttcagacacagatccaggcg
tttgaacatgaactaaccgccttgcaaagccgccatctgcatgagcaacagctagtgagg
gaggtcctgccggagggagaaggcagtggcatgatgacggaaaatgcccgctggggtgaa
ctgatggcgttacaggaagcgtcgccactggtctatccatgggttgatgagcagagcatc
gccgcggtgctttccgattggaccgggatcccgtccggcaaaatgttgcaggacgatatt
gaatgcgtcctgaatcttgaacagcgtctcggtgatcatattttcgggcaacgcaacgct
atcaaagagatttcgcaggcgatacgtattgctcgggcgggcatccagtctcaggagcgg
ccactcgggatcttcctgctggcggggtcaaccggtacgggcaaaacagaaacggccaat
gtactggtcgaaaccttgtatggcggtgctcataaccttattaccttcaatatgagtgag
ttccaagaggcgcataccttatccacgctgaaaggcgcacctccgggctatgtcggctat
ggcaagggggggaaattaaccgaagcggtaagacgcaaaccttattcggtcatcctgctt
gatgagtttgataaagctcacgccgatattcaggacgccttttatcaggtcttcgacaaa
gggtggatggaagatgccgaagggcgtcgggtcagtttccgccagtgtttcatcttactg
acctgtaatcagggcgcggaagagatcgaacaggcttacctcaccgccaacgatatcaaa
cccggtgcattaaaaccgttggtatacgacgccctgttgcgccgctttgcgccagcgctg
ttagccagggtcaatatcattccttatatcccattagatcaggacgctctggcacagatc
gcctctcatcatcttgcgcgcttacaaacgcgcctgtgggatgaaattggtgccactttg
gtgaccgagggggatatccccggctggatcgcctcacgggtttgcagccatccgaaccat
ggtcgtgcggtggaagaactcttgcgtcaaaccttacttcccgctgttggcaatgaagtg
ttgaagcgtcgccatgaggctgaaccgctgagagagatacgcctgattgttgaggagaca
gaactgagtattgagttcgcgtag

DBGET integrated database retrieval system