KEGG   Homo sapiens (human): 5879
Entry
5879              CDS       T01001                                 
Symbol
RAC1, MIG5, MRD48, Rac-1, TC-25, p21-Rac1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1 isoform Rac1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04145  Phagosome
hsa04148  Efferocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04517  IgSF CAM signaling
hsa04518  Integrin signaling
hsa04519  Cadherin signaling
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04972  Pancreatic secretion
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05231  Choline metabolism in cancer
hsa05415  Diabetic cardiomyopathy
hsa05416  Viral myocarditis
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06180  Pathogenic Escherichia coli
nt06181  Salmonella
nt06182  Shigella
nt06183  Yersinia
nt06224  CXCR signaling (cancer)
nt06465  Prion disease
nt06505  WNT signaling
nt06521  NLR signaling
nt06535  Efferocytosis
nt06541  Cytoskeleton in neurons
nt06546  IgSF CAM signaling
nt06549  Cadherin signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00951  ITGA/B-RHOG-RAC signaling pathway
N00952  Shigella IpgB1 to ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01069  Shigella IpgB1 to ITGA/B-FAK-RAC signaling pathway
N01077  Shigella IcsB to ITGA/B-FAK-RAC signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01087  Escherichia EspW to RAC signaling pathway
N01090  IGG-FCGR-RAC signaling pathway
N01102  Yersinia YopE to ITGA/B-RHOG-RAC signaling pathway
N01103  Yersinia YpkA to IGG-FCGR-RAC signaling pathway
N01119  RAC/CDC42-PAK-ERK signaling pathway
N01120  Salmonella SptP to RAC/CDC42-PAK-ERK signaling pathway
N01127  Salmonella SopE to Inflammasome signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01204  PRNP-PI3K-NOX2 signaling pathway
N01205  Scrapie conformation PrPSc to PRNP-PI3K-NOX2 signaling pathway
N01761  Activation of CRK-DOCK-Rac1 pathway
N01763  MEGF10-mediated recognition and engulfment
N01779  Continual efferocytosis enhanced by the AC-derived arginine and ornithine
N01837  Regulation of neurite extension, NAV1-TRIO
N01962  ICAM1 interactions
N02010  Wnt signaling pathway, PCP pathway
Disease
H00773  Autosomal dominant intellectual developmental disorder
Drug target
Plitidepsin: D11032
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5879 (RAC1)
   04014 Ras signaling pathway
    5879 (RAC1)
   04015 Rap1 signaling pathway
    5879 (RAC1)
   04310 Wnt signaling pathway
    5879 (RAC1)
   04370 VEGF signaling pathway
    5879 (RAC1)
   04071 Sphingolipid signaling pathway
    5879 (RAC1)
   04024 cAMP signaling pathway
    5879 (RAC1)
   04151 PI3K-Akt signaling pathway
    5879 (RAC1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    5879 (RAC1)
   04518 Integrin signaling
    5879 (RAC1)
   04519 Cadherin signaling
    5879 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    5879 (RAC1)
   04148 Efferocytosis
    5879 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5879 (RAC1)
   04520 Adherens junction
    5879 (RAC1)
   04530 Tight junction
    5879 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5879 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    5879 (RAC1)
   04620 Toll-like receptor signaling pathway
    5879 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    5879 (RAC1)
   04662 B cell receptor signaling pathway
    5879 (RAC1)
   04664 Fc epsilon RI signaling pathway
    5879 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    5879 (RAC1)
   04670 Leukocyte transendothelial migration
    5879 (RAC1)
   04062 Chemokine signaling pathway
    5879 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    5879 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5879 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    5879 (RAC1)
   04380 Osteoclast differentiation
    5879 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5879 (RAC1)
   05205 Proteoglycans in cancer
    5879 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    5879 (RAC1)
   05203 Viral carcinogenesis
    5879 (RAC1)
   05231 Choline metabolism in cancer
    5879 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    5879 (RAC1)
   05212 Pancreatic cancer
    5879 (RAC1)
   05211 Renal cell carcinoma
    5879 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5879 (RAC1)
   05163 Human cytomegalovirus infection
    5879 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5879 (RAC1)
   05169 Epstein-Barr virus infection
    5879 (RAC1)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5879 (RAC1)
   05130 Pathogenic Escherichia coli infection
    5879 (RAC1)
   05132 Salmonella infection
    5879 (RAC1)
   05131 Shigellosis
    5879 (RAC1)
   05135 Yersinia infection
    5879 (RAC1)
   05100 Bacterial invasion of epithelial cells
    5879 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5879 (RAC1)
   05020 Prion disease
    5879 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    5879 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    5879 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    5879 (RAC1)
   05415 Diabetic cardiomyopathy
    5879 (RAC1)
   05416 Viral myocarditis
    5879 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    5879 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5879 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5879 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5879 (RAC1)
   04031 GTP-binding proteins [BR:hsa04031]
    5879 (RAC1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    5879 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    5879 (RAC1)
  Macropinocytosis
   Ras GTPases
    5879 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    5879 (RAC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5879 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   5879 (RAC1)
  Exosomal proteins of colorectal cancer cells
   5879 (RAC1)
  Exosomal proteins of bladder cancer cells
   5879 (RAC1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    5879 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU CagD
Other DBs
NCBI-GeneID: 5879
NCBI-ProteinID: NP_008839
OMIM: 602048
HGNC: 9801
Ensembl: ENSP00000258737.7
UniProt: P63000 A4D2P1
Structure
Position
7:6374527..6403967
AA seq 192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgacaattat
tctgccaatgttatggtagatggaaaaccggtgaatctgggcttatgggatacagctgga
caagaagattatgacagattacgccccctatcctatccgcaaacagatgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgag
gtgcggcaccactgtcccaacactcccatcatcctagtgggaactaaacttgatcttagg
gatgataaagacacgatcgagaaactgaaggagaagaagctgactcccatcacctatccg
cagggtctagccatggctaaggagattggtgctgtaaaatacctggagtgctcggcgctc
acacagcgaggcctcaagacagtgtttgacgaagcgatccgagcagtcctctgcccgcct
cccgtgaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system