KEGG   Acidovorax sp. JS42: Ajs_1398
Entry
Ajs_1398          CDS       T00455                                 
Name
(GenBank) conserved hypothetical protein
Organism
ajs  Acidovorax sp. JS42
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_22 AAA_16 TrwB_AAD_bind T2SSE AAA_7 ATPase_2 DUF87 AAA_10 AIG1 ABC_tran
Other DBs
NCBI-ProteinID: ABM41613
UniProt: A0A9J9FTP2
Position
complement(1464723..1467590)
AA seq 955 aa
MRWKLPWPKLAASSASDDEQPDGWQRHVDALRQAGIPEPGAAVQGRRPATVADEQALYDV
APSFAELLPWVEFLPQSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQD
SFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARDTAFTEFYLRFFGHHLRAVAKP
GGLFEDTVVTRLRWRGQTRRVRMVIYRRATGQASRRGQTPEQMLNIVCDRLCGGLANAGI
QARRMVAADVHDWLLRWFNPRPAMLGPSAEDRERFYALARYPDETEEGEIELASGRDFSQ
RLFFGQPRSDVEHGTWYFDGMPHRVLITDRLRMPPATGHLTGETRKGDAINTLFDQMPED
TLMCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLYRGTLAF
YLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRRWYT
QLMFAQHIANVSPVWGRAQGTGHPGITVFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGS
GKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFAKRLGLTVNRVKLAPGSGISLAPF
ADARRLIETPSDVQTLDADALDEDLPPDVAAMEADEQRDVLGELEITARLMITGGEDKEE
ARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRTRGQDPTLPEMRRARLLEMAD
AMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLISTVNNIAER
DQYLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPML
NMIEWWVCLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAV
PPSLYLALAQTEPEEKAERYQLMQQHGVSELDAAFKVAEKIDRARGIESPALELS
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgcgctggaaacttccctggccgaagctggccgcatccagcgccagcgacgacgagcag
ccggacggttggcagcgccacgtcgatgccttgcgccaggccggcatccccgaacctggc
gcagcggtccagggccgcaggccggcgacggtagccgacgagcaggcgctgtacgacgtc
gcaccgtcgttcgcggaactgctgccttgggtggagttcctgccgcagtcgaagtccatg
ctgctggaggatgggcagtcggtcgctgccttctacgagctggtgccgctgggcaccgag
ggccgggaacccggctggcttgcgcatgcccgcgatgccttggagaacgcgctccaggac
tcgttcgatgagctggacgaaaacccctgggtgctccagctctacgcccaggacgagccc
agcttcgaccagtacatgcagaccctgcgcgactatgtgcagccgcgcgcccgggatacc
gcgttcaccgaattctacctgcgcttcttcggccaccatctgcgcgcggtcgccaagccg
ggcggcctgttcgaggacacggtagtcacgcggctgcgctggcgcggccagacgcggcgg
gtgcgcatggtgatctatcgccgtgccaccgggcaggcaagccgccgcggccagacaccc
gagcagatgctgaacatcgtctgcgaccgcctgtgcggcggcttggcgaacgccggcatc
caggcacggcgcatggtcgcagccgacgtccacgactggctgctgcggtggttcaatccg
cgccccgcgatgctcgggccgagtgcagaggaccgggagcgcttctacgcgctggcgcgc
taccccgacgagaccgaggaaggcgaaatcgagctggcgagcgggcgggatttcagccag
cggttgttcttcggccagccacgctccgacgtggagcacggcacctggtacttcgacggc
atgccgcaccgtgtgctgatcaccgaccggctccgcatgccgcccgccacgggtcacctg
acgggcgaaacccgcaagggcgatgcgatcaacaccctgttcgaccagatgccggaagac
accttgatgtgtctcaccatggtcgccacaccgcaggatgtgctggaagcggacttgaac
cacctggcgaagaaggccgtgggcgagacgctggcgtcggagcagacgctcaaggacgtg
caggaggcgcggtccctgatcggcagcgcgcacaagctctaccggggaacgctggcgttc
tacctgcgcgggcgcgacgaggcggaactggaccggcgcggcctggacctggcgaacgtg
atgctcaacgccggcttgcagccggtgcgcgaggacgacgaggtggcgccactcaacagc
tacttgcgctggctgccgtgctgctacaaccccggccaggatcggcgcaggtggtacacc
caactgatgttcgcgcagcacatcgcgaacgtatcgccggtgtggggccgcgcccagggt
accgggcatcccggcatcaccgtgttcaaccgcggcggcggcccgatcacgttcgatccg
ctcaaccgcctagaccgacagatgaacgcccacttgttcctgttcggccccaccggctcc
ggcaagagcgccacgctcaacaacctattgaatcaggtcacggccatctaccggccaagg
ctgttcatcgtggaagccggcaacagcttcggcctgttcagcgacttcgccaagcgcctg
ggcctgaccgtgaaccgggtcaagctggcccccggctcgggcatcagcctggcccccttc
gccgacgcgcgccggctgatcgagacgcccagcgacgtgcagacgctcgatgccgatgcg
ctggacgaagacctgccaccggatgtcgcggcgatggaggcagacgagcagcgcgacgtg
ctgggcgaactggagatcacggcacggctgatgatcacgggcggcgaagacaaggaagaa
gcgcggatgacgcgggccgaccgctcgctgatccgccagtgcatcctcgacgccgccgaa
cattgcgtggcggagaagcgcaccgtgctcacgcgcgatgtgcgcaatgcactgcgcacc
cgtggccaggacccgacgttgcccgagatgcgccgtgcgcggctgctggagatggcggac
gcgatggacatgttctgccaaggcacggacggcgagatgttcgaccgcgacggcacgccg
tggcccgaggccgacatcacgctggtcgatctggcgacctatgcccgcgagggctacaac
gcgcagctctccatcgcctacatcagcctgatcagcacggtgaacaacatcgccgagcgc
gaccagtacctgggacggccgatcgtcaacgtgaccgacgaaggtcacatcatcaccaag
aacccgctgctcgcgccctacgtcgtgaaaattacaaaaatgtggcgcaagttgggcgcc
tggttctggctggcgacgcagaacatcgacgacctgccacgtgcagcggagccgatgctc
aacatgatcgagtggtgggtgtgcctgtcgatgccgccggacgaggtggagaagatcgcg
cgcttccgcgaactctcgccggcgcagaaggcgctgatgctctccgcacgcaaggaagcg
ggcaagttcaccgagggcgtcatcctctccaagagcatggaagtgctgttccgcgccgtg
ccgccaagtctctacctcgcgctcgcgcaaaccgagcccgaggagaaggcagaacgctac
caactcatgcagcagcacggcgtcagcgagctggatgccgccttcaaggtggctgagaag
atcgaccgggcacgtggcatcgagtcgccggccttggaactgtcgtaa

DBGET integrated database retrieval system