KEGG   Achromobacter xylosoxidans A8: AXYL_01106
Entry
AXYL_01106        CDS       T01341                                 
Name
(GenBank) type IV secretory pathway, VirB4 component
Organism
axy  Achromobacter xylosoxidans A8
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE TrwB_AAD_bind AAA_10 T2SSE ATPase_2 AAA_7 AAA_16 DUF87 AIG1
Other DBs
NCBI-ProteinID: ADP14450
UniProt: E3HKS5
Position
1174433..1177327
AA seq 964 aa
MRWKLPWPKPAAPKLAASGAGDDEQPDGWQRHVEALRQVGIPEPGSAVRGRKPATEADEQ
ALYDVAPSFVELLPWVEFLPESKSMLLEDGQSVAAFFELVPLGTEGREPGWLAHARDALE
NALQDSFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARGTVFTEFYLRFFAHHLR
AVAKPGGLFQDTVVTRLRWRGQTRRVRMVVYRRVTGQGQGQANRRGQTPEQMLNIVCDRL
CGGLANAGIQARRLGAADVHDWLLRWFNPRPTLLGPGVEDRERFYAFARYPADTEAGEIE
LASGRDFSQRLFFSQPRSDVEHGTWHFDGIPHRVLVTDRLRMPPGTGHLTGETRKGDAIN
TLFDQMPEDTTMCLTMVATPQDILESHLNHLAKKAVGETLASEQTLKDVQEARSLIGSAH
KLYRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNP
AQDRRNWFTQLMFAQHVANLSPAWGRSQGTGHPGNTFFNRGGGPITFDPLNRLDRQMNAH
LFLFGPTGSGKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFARRLGLTVNRVKLAP
GSGISLAPFADARRLIETPSDVQTLDADALDEDLPPDASVMEADEQRDVLGELEITARLM
ITGGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRARGQDSTLPEMR
RMRLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLI
STVNNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDD
LPRAAEPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEGGKFTEGVILSK
SMEVLFRAVPPSLYLALAQTEPEEKAERYQLMQQYGCTELEAAFKVAEKIDQARGIESPA
LELS
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgcggtggaaacttccctggcctaagccggccgcgccgaagctggccgcatccggcgct
ggtgatgatgagcagccggacggctggcagcgccacgtcgaggccttgcggcaggtcggc
atccccgaacccggctcggcagtccggggccgcaagccggcgacggaggccgacgagcag
gcgctgtacgacgtcgcaccgtccttcgtggaactgctgccctgggtggagttcttgccc
gagtcgaaatcgatgctcctggaggacggccaatcggtggccgccttcttcgagctggtg
ccgctggggaccgagggccgggaacccggctggctcgcgcacgcccgcgacgccttagaa
aacgcgctccaggacagcttcgatgaactggacgagaacccctgggtgttgcagctctac
gcccaggacgaaccgagcttcgaccagtacatgcagacgttgcgcgactacgtgcagccg
cgcgcccgtggcacggtgttcacggagttctacctgcggttctttgcccaccatctgcgc
gcggtggccaagcccggtggcttgttccaggacacggtggtcacacgcttgcgctggcgc
ggccagacgaggcgtgtgcgcatggtcgtctatcgccgcgtgaccggacaaggacagggc
caggcaaaccgccggggccagacacccgagcagatgctgaacatcgtctgcgaccgcctg
tgcggcgggctggcgaacgccggcatccaggctcgccgcctgggtgcggcagacgtccat
gactggctgctgcgctggttcaacccgcgtccgacgctgctcgggcctggggtcgaggac
cgggagcgcttctatgcgttcgcgcgctaccccgccgacaccgaggctggcgagatcgaa
ctggcgagcgggcgggattttagccagcggcttttcttcagccagccacgctcggacgtg
gagcatggcacctggcacttcgacggcataccgcaccgtgtgttggtcactgaccggctg
cgcatgccgcccggaacgggacacctgactggcgaaacccgcaagggcgatgcgatcaac
acgctgttcgatcagatgcccgaggacacgacgatgtgtctgaccatggtggcgacgccc
caggacattctcgaatcgcacctgaaccacctggcgaagaaggcagtcggcgaaacactg
gcatcggagcagacgctcaaggacgtgcaggaggcgcgctcgctcatcggcagcgcgcac
aaactctaccgcggcacgctggccttctatctgcgcggacgcgacgaagccgagcttgac
cggcgcggtctggacctcgccaacgtgatgctcaacgcggggttgcagcccgttcgcgag
gacgatgaagtcgcgccgctcaacagctatctgcgctggctaccgtgctgctacaacccc
gcgcaggatcggcgaaactggttcacccaactgatgttcgcccagcatgtggcgaatctc
tcgccggcgtggggtcgcagccagggtacgggccatccgggcaacacgttcttcaaccgc
ggtggcgggccgatcacgtttgatccgctgaaccgcttagacaggcagatgaatgcccat
ctattcctgttcggccccaccggctcgggcaagagcgccacgctcaacaacctgctgaac
caggtcacggccatctaccggccgcgcctcttcatcgtggaagccggcaacagcttcggg
ctgttcagcgacttcgccaggcgcctgggcctgacggtgaaccgggtcaagctggccccc
ggatcgggcatcagcctggcaccgttcgcggatgcccgccggctgatcgaaacacccagc
gacgtgcagacgctcgatgccgatgcgttggacgaagacctgccaccggatgcctcggtc
atggaggcagacgaacagcgtgacgtgttgggcgagttggagatcacggcacggctgatg
atcaccggcggcgaggacaaggaggaagcccggatgacgcgggccgaccgttcgctgatc
cgccagtgcatcctcgacgccgccgaacactgcgtggctgagaagcgcacggtgctcact
cgcgacgtgcgcaacgcgctgcgcgcccgcggtcaggactcgacgcttcccgagatgcgg
cgcatgcggctgctggagatggcggacgcgatggacatgttctgccaaggcaccgatggc
gagatgttcgaccgcgatggcacgccgtggcccgaggccgacatcacgctggtggatctg
gcgacctatgcccgcgagggctacaacgcgcagctctccatcgcctacatcagcctgatc
agcacggtgaacaacatcgccgagcgcgaccagtacctgggtcgtccgatcatcaatgtg
accgacgaaggccacatcatcacgaagaacccgttgctcgcgccctacgtcgtgaaaatt
accaagatgtggcgcaaattgggcgcctggttctggctggcgacccagaacatcgacgac
ctgccgcgtgccgcagagcccatgctcaacatgattgagtggtggatctgcctgtcgatg
ccgcccgatgaggtcgagaagattgcacgcttccgtgaactctcaccagcgcagaaagcg
ctgatgctttctgcgcgcaaggagggggggaaattcaccgagggcgtgatcctgtcgaag
tcgatggaagtgttgttccgcgcggtgccgccgagcctttacctcgcgcttgcgcagacc
gaacccgaggagaaggccgagcgctaccagctcatgcagcaatacggctgcaccgagctg
gaagccgccttcaaggtggccgagaagatcgaccaggcacgcggcatcgagtcgcccgcc
ttggaactgtcgtaa

DBGET integrated database retrieval system