KEGG   Bradyrhizobium sp. BTAi1: BBta_7440
Entry
BBta_7440         CDS       T00528                                 
Symbol
trbB
Name
(GenBank) Conjugal transfer protein trbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
bbt  Bradyrhizobium sp. BTAi1
Pathway
bbt02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bbt00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBta_7440 (trbB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbt02044]
    BBta_7440 (trbB)
Enzymes [BR:bbt01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BBta_7440 (trbB)
Secretion system [BR:bbt02044]
 Type IV secretion system
  Trb secretion system protein
   BBta_7440 (trbB)
SSDB
Motif
Pfam: T2SSE AAA_16 Zeta_toxin AAA_30 DEAD AAA_19 AAA_7 nSTAND3 FtsK_SpoIIIE TrwB_AAD_bind DUF815 MMR_HSR1 AAA_29 AAA_28 ABC_ATPase ATPase AAA_11 MobB ResIII IstB_IS21 AAA_25 MoCF_biosynth RsgA_GTPase Sigma54_activat CbiA Dynamin_N GTP_EFTU TniB TsaE Septin
Other DBs
NCBI-ProteinID: ABQ39299
RhizoBase: BBta_7440
UniProt: A5ET05
Position
7815685..7816602
AA seq 305 aa
MLRTALGPAISGYLEDPSIVEVMLNPDGRLWIDRLSGGLEDTGCRVTPADAERIVRLVAH
HVGVEVHAGSPRVSAELPESGERFEGLVPPVVAAPCFAIRRPAVAVYTLGDYVEAGIMSA
DQAELLRAAVRDRKNVLVAGGTSTGKTTLVNAILAEVAKTGDRIVLIEDTRELQCAAPNL
VALRTKDGAASLSDLVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGVGTLHAGSA
IGALRRLEQLIQEAVVTVPRALIAETIDLIAVLTGRGSARRLAELAAVKGLSPAGDYVLT
PAGEP
NT seq 918 nt   +upstreamnt  +downstreamnt
atgctgcgcacggcgcttggtccggcgatctccggctatctcgaagatcccagcatcgtc
gaggtgatgctcaaccctgacggtcgcctctggatcgatcggctgtcaggcggtcttgaa
gacaccggctgtcgcgtcacgcccgcggacgccgagcgcatcgtgcgcctggtcgcgcac
catgtcggggtcgaagtgcatgccggcagcccgcgcgtctcggcggaattgccggaaagc
ggggagcggttcgagggcctggtgccgcccgtggtggctgcgccgtgctttgccatccgg
cggccggccgtcgccgtttacacgctcggcgactacgtcgaggccggcatcatgtcggcc
gaccaggccgagctgctccgcgcggccgtgcgcgaccgaaagaacgtgctggtcgccggc
gggacgagcaccggcaagacgacgctggtcaacgcgatcctcgcagaagtcgccaagacc
ggcgaccgcatcgtgctcatcgaggatacgcgcgagttgcaatgcgccgcgccgaacctc
gtggcgctgcgcaccaaggacggggctgcgtcgctgtctgatctggtccgctcgtcgctg
cgcctgcggcccgaccgcatcccaatcggcgaggttcgcggggcagaggcgctcgatctt
ctgaaagcctggggcacgggacaccccgggggcgtgggcacgctgcacgcaggctccgcc
atcggcgcactgcgccggctcgaacagctcatccaggaagccgtggtcaccgttccgcgc
gcgctcatcgccgagacgatcgacctcatcgcggtcctcaccggccgcggctccgcgcgc
cggctcgccgagctcgcagcggtgaagggcctctcgcccgccggcgactacgtcctcacc
cccgcaggagaaccgtga

DBGET integrated database retrieval system