KEGG   Bordetella petrii: Bpet4265
Entry
Bpet4265          CDS       T00637                                 
Name
(GenBank) conserved hypothetical protein
Organism
bpt  Bordetella petrii
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_22 TrwB_AAD_bind AAA_10 T2SSE ATPase_2 AAA_7 AAA_16 DUF87 AIG1
Other DBs
NCBI-ProteinID: CAP44614
UniProt: A9IAP7
Position
complement(4524784..4527693)
AA seq 969 aa
MRWKIPRPKPTAPKLAASDADDDEQPDGWQRHVEALRQAGIPEPGTAVQGRRPATLADEQ
ALYEVAPSFVELLPWVEFLAQSKAMLLEDGQSVAAFYELVPLGTEGREPGWLAQARDALE
NALQDSFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARETAFTEFYLRFFGHHLR
AVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYRRVTGQGQNSRRGQTPEQMLNIVCDRLCG
GLANAGIQARRMVAADVHDWLLRWFNPRPTLLGPGAEDRERFYALARYPDSTEAGEDGEI
ELASGRDFSQRLFFGQPRSDVAQGTWHFDGLPHRVLITDRLRMPPGTGHLTGETRKGDAI
NTLFDQMPEDTTLCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVHEARSLIGSA
HKLYRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYN
PGQDRRKWYTQLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNA
HLFLFGPTGSGKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFARRLGLTVNRVKLA
PGSGVTLAPFADARRLIETPSDVQTLDADALDEDLPPDAVAMEADEQRDVLGELEITARL
MITGGEDKEEARMTRADRSLIRQCILDAAEHCHSKDGEKRTVLTRDVRNALRTRSQDPTL
PEMRRVRLLEMADAMDMFCQGTDGEMFDRDGSPWPEADITLVDLATYAREGYNAQLSIAY
ISLISTVNNIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQ
NIDDLPRAAEPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGV
ILSKSLEVLFRAVPPSLYLALAQTEPEEKAERYQLMQQHGISELDAAFKVAEKIDQARGI
ESPALGLPQ
NT seq 2910 nt   +upstreamnt  +downstreamnt
atgcgctggaaaatccccagaccgaagccgaccgcgccgaagctggccgcatccgatgct
gacgacgacgagcagccggacggctggcaacgccacgtcgaggcactgcgccaggccggc
atccccgaacccggcacggcggtgcaaggccgcaggccggcgaccctggcagacgagcag
gcgctgtacgaggtcgcgccgtcgttcgtggaactgctgccctgggtggagttcctggcg
cagtcgaaagccatgttgctggaggacgggcaatcggtggcggcgttctacgagctggtg
ccgctgggcaccgaaggccgggaacctggctggctcgcgcaggcccgcgatgccttggaa
aacgcgctgcaggacagtttcgatgaactggatgagaacccctgggtgctgcagctctac
gctcaggacgagcccagtttcgaccagtacatgcagaccctgcgcgactatgtgcagccg
cgcgcccgtgagacggcgttcaccgagttctacctgcgcttcttcggccatcacctgcgc
gcggtggccaagccgggcggtctgttcgaggacacggtggtcacacggctgcgctggcgc
ggccagacccggcgtgtgcgcatggtggtctatcgccgcgtgaccggccaagggcaaaac
agccgccgcgggcagacgcccgagcagatgctcaatatcgtttgcgaccgcctgtgcggc
ggactggcgaacgccggcattcaggcccggcgcatggtggctgcggatgttcacgactgg
ctgctgcgctggttcaacccgcgtcccacgttgcttgggcctggggccgaagacagggag
cgcttctatgcgctggcgcgctaccccgacagtacggaggccggcgaagacggcgagatc
gaattggcgagcgggcgggatttcagccagcggctgttcttcggccagccgcgctccgac
gtggcgcagggcacctggcatttcgacggcctgccgcaccgcgtgctgatcaccgaccgc
ctgcgcatgccgccgggcacagggcacctgaccggcgagacacgcaaaggcgatgccatc
aacacgctgttcgaccagatgcccgaggacaccaccctttgcctgacgatggtcgccacg
ccgcaggatgtccttgaggcggacttgaaccacctggccaagaaagcggtcggcgaaacc
ctggcgtcggagcagacgctcaaggacgtgcatgaagcccgttccctgatcggcagcgcg
cacaagctctatcgcggcacgctggcgttctacctgcgcgggcgcgatgaggcggaactg
gaccgacgcggcctggatctggcgaacgtcatgctcaacgctggcctgcagccggtgcgc
gaggacgacgaggtggcaccgctcaacagctacctgcgctggctgccgtgctgctacaac
cccggccaggatcggcgcaagtggtacacccaactgatgttcgcccagcacgcggcgaac
ctctcgccggtgtggggccgcgcccagggtacggggcaccccggcatcacgatgttcaac
cgcggcggcgggccgatcaccttcgacccgctcaaccgcctggaccggcagatgaacgcc
cacctgttcctgttcggcccgacgggttcgggcaagtcggcgaccctcaacaacctcttg
aatcaggtcacggcgatctaccgaccccgcctgttcattgtcgaggccggcaacagcttt
ggcttgttcagcgactttgcccggcgcctgggcctgaccgtgaaccgggtcaagctcgcg
ccgggctcgggcgttaccctggcgccgttcgcggatgcgcgccggctgatcgagacgccc
agcgacgtgcagacgctcgacgccgatgccctggacgaagacctgccgcccgatgctgtg
gccatggaggcagatgagcagcgcgacgtactgggcgaattggagatcaccgcgaggctg
atgatcaccggtggcgaagacaaggaagaagcccggatgacgcgggccgaccgctcgctg
atccgtcagtgcatcctcgatgccgcagaacactgccacagcaaggatggcgagaagcgc
accgtgctcacgcgcgatgtgcgcaatgcgctgcgcacgcgcagccaggacccgacgctg
ccggaaatgcggcgtgtgcgactgctggagatggccgacgccatggacatgttctgccaa
ggcacggacggtgaaatgttcgaccgcgacggttcgccgtggcccgaggccgacatcacc
ctggtcgatctggcgacctatgcccgcgagggctacaacgcgcagctctccattgcctac
ataagcctgatcagcacggtgaacaacattgccgagcgcgatcagtacctgggccgcccg
atcatcaacgtcaccgacgaagggcacatcatcaccaagaacccgctgctcgccccctac
gtggtgaagatcaccaagatgtggcgcaagctgggggcctggttctggctcgccacacaa
aacatcgacgatctgccgcgcgccgcagagcccatgctcaacatgatcgagtggtggatc
tgcctgtcgatgccacccgatgaggtggagaagatcgcccgcttccgcgaactctcgcct
gcgcagaaggcgctgatgctttcggcgcgcaaggaagccgggaagttcaccgagggcgtc
atcctctccaagagcctggaagtgctgtttcgggccgtgccaccgagcctctatctcgcg
cttgcgcagaccgaacccgaggagaaagccgagcgttaccaactcatgcaacagcacggc
atcagtgaactcgacgcggccttcaaggtggccgagaagatcgaccaggcgcgcggcatc
gagtcgccggccttgggcctgccgcaatag

DBGET integrated database retrieval system