KEGG   Bacillus subtilis subsp. subtilis 168: BSU16400Help
Entry
BSU16400          CDS       T00010                                 

Gene name
flhF
Definition
(RefSeq) flagellar biosynthesis protein FlhF
  KO
K02404  flagellar biosynthesis protein FlhF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16400 (flhF)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    BSU16400 (flhF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 cobW AAA_24 Zeta_toxin MMR_HSR1 AAA_19 UvrD-helicase AAA_28 T2SSE AAA_14 CbiA ABC_tran ResIII AAA_22 AAA_30 RsgA_GTPase AAA_33 TsaE ATPase_2 DLIC Terminase_6 PhoH AAA_16 Roc FtsK_SpoIIIE DUF87
Motif
Other DBs
NCBI-GeneID: 940021
NCBI-ProteinID: NP_389522
Pasteur: BG10544
BSORF: BG10544
UniProt: Q01960
Structure
PDB: 

Position
1709747..1710847
Genome map
AA seq 366 aa AA seqDB search
MKIKKFTAASMQEAALLIRKELGNEAVILNSKKIKKRKWFGLVNKPAVEVIAVLDQDFLE
KKTPQKAAEPKQTLKTPVSSPKIEERTYPPQIPAQQELGDFSAYQSVLPEPLRKAEKLLQ
ETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVL
FGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTK
EEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMK
HIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGF
VRMLCR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaaaatttactgctgcttcaatgcaagaagcggcacttctcatcagaaaa
gagttaggtaatgaagcggtcatattaaattcgaaaaaaattaaaaagcgaaaatggttt
ggcctcgtcaacaagcctgctgttgaagtaatcgccgtattggatcaggactttcttgag
aaaaaaacgcctcagaaggcagctgaaccgaaacaaacattaaaaactccggtcagcagt
ccaaaaatagaggagagaacatatccccctcaaattccggcgcaacaggagctaggtgat
ttttcagcatatcaatctgtacttcctgagccgctgcgaaaagcagaaaagcttttgcaa
gaaacagggatcaaagagtctacgaaaacgaacactctgaaaaaattgcttcgcttctct
gttgaagcaggcggcttgactgaagaaaatgttgtcggcaaacttcaggaaatactatgc
gatatgctgccctcagcagacaagtggcaggagccaattcattcaaaatatatcgttctc
tttggttcaacaggggctggtaaaacaactacactggctaaactcgcagccatatctatg
cttgaaaaacataaaaaaatcgcttttattacaacagatacgtatcgtattgcagctgtt
gaacagttgaaaacatacgctgaactgctgcaggctcctctggaagtttgctatacaaaa
gaagaatttcagcaggcgaaggagctattttctgagtatgatcatgtgtttgttgataca
gctggaagaaacttcaaagacccgcaatacattgatgaactgaaagaaacgattcctttt
gagagcagcattcagtcatttcttgttttatccgcgactgcaaaatatgaagatatgaag
catattgtcaaacggttttcatccgtccctgtcaatcagtatatttttacgaaaatagat
gaaacgacttccttaggttctgtatttaatatactggcagaatcaaaaataggtgtcggg
tttatgactaacggccagaatgtgcctgaggatatacagactgtatctccacttggtttt
gtgaggatgctgtgcagatga

DBGET integrated database retrieval system