KEGG   Bacillus subtilis subsp. subtilis 168: BSU16400
Entry
BSU16400          CDS       T00010                                 

Symbol
flhF
Name
(RefSeq) flagellar biosynthesis protein FlhF
  KO
K02404  flagellar biosynthesis protein FlhF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU16400 (flhF)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Flagellar assembly proteins
   Others
    BSU16400 (flhF)
SSDB
Motif
Pfam: SRP54 AAA_24 cobW Zeta_toxin MMR_HSR1 AAA_19 UvrD-helicase AAA_14 AAA_28 CbiA T2SSE ABC_tran ResIII AAA_22 PduV-EutP AAA_30 RsgA_GTPase TsaE Terminase_6N ATPase_2 DLIC AAA_33 YqeC PhoH AAA_16 Roc DO-GTPase2 FtsK_SpoIIIE DUF87
Other DBs
NCBI-GeneID: 940021
NCBI-ProteinID: NP_389522
Pasteur: BG10544
BSORF: BG10544
UniProt: Q01960 A0A6M3ZED1
Structure
PDB: 
2PX0 3SYN 2PX3

Position
1709747..1710847
AA seq 366 aa
MKIKKFTAASMQEAALLIRKELGNEAVILNSKKIKKRKWFGLVNKPAVEVIAVLDQDFLE
KKTPQKAAEPKQTLKTPVSSPKIEERTYPPQIPAQQELGDFSAYQSVLPEPLRKAEKLLQ
ETGIKESTKTNTLKKLLRFSVEAGGLTEENVVGKLQEILCDMLPSADKWQEPIHSKYIVL
FGSTGAGKTTTLAKLAAISMLEKHKKIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTK
EEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQSFLVLSATAKYEDMK
HIVKRFSSVPVNQYIFTKIDETTSLGSVFNILAESKIGVGFMTNGQNVPEDIQTVSPLGF
VRMLCR
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaaaataaaaaaatttactgctgcttcaatgcaagaagcggcacttctcatcagaaaa
gagttaggtaatgaagcggtcatattaaattcgaaaaaaattaaaaagcgaaaatggttt
ggcctcgtcaacaagcctgctgttgaagtaatcgccgtattggatcaggactttcttgag
aaaaaaacgcctcagaaggcagctgaaccgaaacaaacattaaaaactccggtcagcagt
ccaaaaatagaggagagaacatatccccctcaaattccggcgcaacaggagctaggtgat
ttttcagcatatcaatctgtacttcctgagccgctgcgaaaagcagaaaagcttttgcaa
gaaacagggatcaaagagtctacgaaaacgaacactctgaaaaaattgcttcgcttctct
gttgaagcaggcggcttgactgaagaaaatgttgtcggcaaacttcaggaaatactatgc
gatatgctgccctcagcagacaagtggcaggagccaattcattcaaaatatatcgttctc
tttggttcaacaggggctggtaaaacaactacactggctaaactcgcagccatatctatg
cttgaaaaacataaaaaaatcgcttttattacaacagatacgtatcgtattgcagctgtt
gaacagttgaaaacatacgctgaactgctgcaggctcctctggaagtttgctatacaaaa
gaagaatttcagcaggcgaaggagctattttctgagtatgatcatgtgtttgttgataca
gctggaagaaacttcaaagacccgcaatacattgatgaactgaaagaaacgattcctttt
gagagcagcattcagtcatttcttgttttatccgcgactgcaaaatatgaagatatgaag
catattgtcaaacggttttcatccgtccctgtcaatcagtatatttttacgaaaatagat
gaaacgacttccttaggttctgtatttaatatactggcagaatcaaaaataggtgtcggg
tttatgactaacggccagaatgtgcctgaggatatacagactgtatctccacttggtttt
gtgaggatgctgtgcagatga

DBGET integrated database retrieval system