KEGG   Bacillus subtilis subsp. subtilis 168: BSU29780
Entry
BSU29780          CDS       T00010                                 

Symbol
ytxG
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF948 Mce4_CUP1 MukF_M Laminin_II DUF4446 DUF6377 DUF4795 Apolipoprotein GAS ATG17_like DUF1664 Laminin_I SKA1 Spore_III_AB COG6 COG5 DUF6507 CLZ Seryl_tRNA_N Fib_alpha DUF2203 Sec34 Snapin_Pallidin TMF_TATA_bd Cluap1
Other DBs
NCBI-GeneID: 937386
NCBI-ProteinID: NP_390856
Pasteur: BG10974
BSORF: BG10974
UniProt: P40779 A0A6M3ZFK9
Position
complement(3047593..3048015)
AA seq 140 aa
MIIILYLSVALIAVAFLVLVIYLSKTLKSLQLTLKNVASTLEGLEGQMKGITTETAELLH
KTNRLAEDIQEKSEKLNTVVHAVQGVGASVQQFNTSMKQAAGSVSASVRENQDKINQVVT
WSQAAMEIWEKWKQKKKSAL
NT seq 423 nt   +upstreamnt  +downstreamnt
atgattattattctttatttgagcgttgcactcatcgcagttgcatttctcgtattagtg
atctacttgtctaaaacattgaagtcactgcagctgacactaaaaaacgtcgcatccact
cttgaagggctggagggacaaatgaagggcatcacaactgaaacagccgagcttttacat
aagaccaaccgcctggctgaagatattcaggaaaaatcagaaaagctgaacacggtcgtt
catgctgttcaaggagtgggagcttctgtacagcagttcaatacatccatgaaacaagcg
gcagggtctgtatcggcatcagttagagagaatcaagataagatcaatcaagttgtcact
tggagtcaagcagcaatggaaatttgggagaaatggaagcaaaagaaaaaatcagccctg
taa

DBGET integrated database retrieval system