KEGG   Bacillus subtilis subsp. subtilis 168: BSU29780Help
Entry
BSU29780          CDS       T00010                                 

Gene name
ytxG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF948 Laminin_II MukF_M Mce4_CUP1 DUF4446 DUF4795 DUF1664 Spore_III_AB Laminin_I SKA1 GAS TMF_TATA_bd Apolipoprotein Pro-NT_NN COG6 DUF3858 COG5 CLZ DUF2203 Snapin_Pallidin Seryl_tRNA_N Fib_alpha Atg14 Sec34 YabA Cluap1
Motif
Other DBs
NCBI-GeneID: 937386
NCBI-ProteinID: NP_390856
Pasteur: BG10974
BSORF: BG10974
UniProt: P40779
Position
complement(3047593..3048015)
Genome map
AA seq 140 aa AA seqDB search
MIIILYLSVALIAVAFLVLVIYLSKTLKSLQLTLKNVASTLEGLEGQMKGITTETAELLH
KTNRLAEDIQEKSEKLNTVVHAVQGVGASVQQFNTSMKQAAGSVSASVRENQDKINQVVT
WSQAAMEIWEKWKQKKKSAL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgattattattctttatttgagcgttgcactcatcgcagttgcatttctcgtattagtg
atctacttgtctaaaacattgaagtcactgcagctgacactaaaaaacgtcgcatccact
cttgaagggctggagggacaaatgaagggcatcacaactgaaacagccgagcttttacat
aagaccaaccgcctggctgaagatattcaggaaaaatcagaaaagctgaacacggtcgtt
catgctgttcaaggagtgggagcttctgtacagcagttcaatacatccatgaaacaagcg
gcagggtctgtatcggcatcagttagagagaatcaagataagatcaatcaagttgtcact
tggagtcaagcagcaatggaaatttgggagaaatggaagcaaaagaaaaaatcagccctg
taa

DBGET integrated database retrieval system