KEGG   Paraburkholderia xenovorans LB400: Bxe_A1184
Entry
Bxe_A1184         CDS       T00340                                 
Name
(GenBank) Conserved hypothetical protein
Organism
bxe  Paraburkholderia xenovorans LB400
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_22 TrwB_AAD_bind AAA_16 T2SSE AAA_7 ATPase_2 AAA_10 DUF87 AIG1 ABC_tran
Other DBs
NCBI-ProteinID: ABE31769
UniProt: Q13VX0
Position
1:3601362..3604229
AA seq 955 aa
MRWKLPWPKLAASGAGEDEQPDGWQRHVETLRQAGIPEPGAAVQDRRPATLADEQALYDV
APSFTELLPWVEFLPQSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQD
SFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARGTAFTEFYLRFFGHHLRAVAKP
GGLFEDTVVTRLRWRGQTRRVRMVVYRRATGQASRRGQTPEQMLNIVCDRLCGGLANAGI
QARRMDAAGVHDWLLRWFNPRPTLLGPGVEDRERFYALARYPDETEEGEIELASGRDFSQ
RLFFGQPRSDVAHGTWHFDGMPHRVLITDRLRMPPGTGHLTGETRKGDAINTLFDQMPED
TLMCLTMVATPQDVLEADLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLYRGTLAF
YLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGQDRRKWYT
QLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGS
GKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFAKRLGLTVNRVKLSPGSGISLAPF
ADARRLIETPSDVQTLDADALDEDLPPDASAMEADEQRDVLGELEITARLMITGGEDKEE
ARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRARGQDPTLPEMRRVRLLEMAD
AMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLISTVNNIAER
DQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPML
NMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAV
PPSLYLALAQTEPEEKADRYQLMQQYGCTELEAAFKVAEKIDQARGIESPALELS
NT seq 2868 nt   +upstreamnt  +downstreamnt
atgcgctggaaactcccctggccgaagctggccgcatccggcgctggcgaggacgagcag
ccggacggctggcagcgccacgtcgagaccttgcgacaggccggcatccctgaacccggc
gcggcggtccaggaccgcaggccggcgaccttggcagacgagcaggcgctgtacgacgtc
gcgccgtccttcacggaactgctgccttgggtggagtttctgccccaatcgaagtccatg
ctgctggaggacgggcaatcggtcgcggccttctacgagctggtgccgctgggcaccgaa
ggtcgggaacccggctggctcgcgcatgcccgagatgcgctcgaaaacgcgctgcaagac
tcgttcgacgaactggacgagaacccctgggtgcttcagctctacgcgcaggacgagccc
agcttcgaccagtacatgcagaccctgcgcgactacgtgcagccgcgcgcccgcggcacg
gcgttcacggagttctatttgcgcttcttcggccaccacctgcgggcggtggccaagccg
ggcgggctgttcgaggacacggtggtcacgcggctgcgctggcggggtcagacgcggcgc
gtgcgcatggtcgtctatcgccgggccaccggacaggcgagccgccgcggccagacgcca
gaacaaatgctcaatatcgtctgcgaccgcctgtgcggcgggctggcgaacgctggcatc
caggctcggcgcatggatgcggccggggttcacgattggcttttgcgctggttcaacccg
cgcccaactctgctggggccgggcgtggaagaccgcgagcggttctacgcgctcgcgcgc
taccctgacgagaccgaggaaggcgagatcgagcttgcgagcgggcgtgatttcagccag
cggctgttcttcggccagccgcgatccgacgtggcgcacggcacctggcacttcgacggc
atgccgcatcgcgtgctgatcaccgaccgcctgcgcatgccgcccggcacggggcacttg
accggcgaaacccgcaagggcgatgcgatcaacaccctgttcgaccagatgccggaagac
acgctgatgtgtctcacgatggttgccacaccgcaggatgtcctggaagcggacctcaac
cacctggcaaagaaggccgtgggagagacgctggcgtcggagcagacgctcaaggacgtg
caggaggcccgctcgctgatcggcagcgcgcataagctctaccggggaactctggcgttc
tacctgcgcgggcgcgacgaggcggaactggaccggcgcgggctggacttggcgaacgtc
atgctcaatgccggcttgcagccggtgcgcgaggacgacgaggtggcgccgctcaacagc
tacttgcgctggctaccgtgctgctacaaccccggccaggatcggcgcaagtggtacacc
caactgatgttcgcccagcacgcggcgaacctgtcgccggtgtggggccgcgcccagggt
acggggcaccccggcatcacgatgttcaaccgcggtggtgggccgatcaccttcgacccg
ctcaaccgcctggaccggcagatgaacgcgcatctgttcctgttcggtcccaccggctcc
ggtaagagcgccacactcaacaacctcttgaaccaggtcacggccatctaccggccgcgc
ctcttcatcgtggaagccggcaacagcttcggcctgttcagcgatttcgccaagcgcctg
ggcctcaccgtaaaccgggtcaagctgtcacctggctcgggcatcagcctcgcgccattc
gccgatgcgcgccggctgatcgagacgccaagcgacgtgcagacgctcgatgccgatgcg
ctggatgaagacctaccaccggatgcctcggccatggaggcggacgaacagcgtgacgtg
ctgggcgaactggagatcacggcgcgtttgatgatcacgggcggcgaagacaaggaagaa
gcccggatgacgcgggccgatcgctcgctcatccgccagtgcatcctcgacgccgccgag
cactgcgtggccgagaagcgcacggtcctcacgcgcgacgtgcgcaatgcgctgcgcgcc
cggggccaggacccgacactgcccgagatgcgccgcgtgcggctgctggagatggcagac
gcgatggacatgttctgccaaggcacggacggcgaaatgttcgaccgcgacggcacgccg
tggcccgaagccgacatcacgctggtggatctggcgacctacgctcgtgagggctacaac
gcccagctctccatcgcttacatcagcctgatcagcacggtgaacaacatcgccgagcgc
gaccagtatctgggccgcccgatcatcaacgtgaccgacgaagggcacatcatcacgaag
aacccgctgctcgcgccctacgtggtcaagatcacgaagatgtggcgcaagttgggggcc
tggttctggctcgcgacgcagaacatcgacgacctgccgcgtgccgcagagcccatgctc
aacatgatcgagtggtggatctgcctgtcgatgccgccggacgaggtggagaagatcgcc
cggttccgcgaactctcgcccgcgcagaaggcgctgatgctttcggcgcgcaaagaggcg
gggaaattcaccgagggcgtcatcctctccaagagcatggaagtgctcttccgcgctgtg
ccgccaagcctctacctcgcgctcgcgcaaaccgaacccgaagagaaggccgaccgctac
cagctcatgcagcaatacggctgcaccgaactggaagcggccttcaaggtggccgagaag
atcgaccaggcacgcggcatcgagtcgccagccctggaactgtcgtaa

DBGET integrated database retrieval system