KEGG   Caenorhabditis elegans (nematode): CELE_C09D1.1Help
Entry
CELE_C09D1.1      CDS       T00019                                 

Gene name
unc-89
Definition
(RefSeq) Muscle M-line assembly protein unc-89
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Pkinase C2-set_2 BiPBP_C RCSD Receptor_2B4 Pkinase_Tyr fn3 C1-set Ig_5 RhoGEF Kdo PKD_3 SH3_2
Motif
Other DBs
NCBI-GeneID: 171990
NCBI-ProteinID: NP_001020985
WormBase: WBGene00006820
UniProt: O01761
Structure
PDB: 

Position
I:join(4035893..4035942,4036629..4036902,4036947..4037083,4038490..4038660,4038710..4038872,4044800..4044981,4045025..4045103,4045496..4045716,4046020..4046102,4047250..4047387,4047965..4048075,4048124..4048350,4048906..4049649,4049972..4050040,4050093..4050308,4051955..4052142,4052456..4052939,4053398..4053583,4054476..4054541,4055391..4057244,4058536..4058892,4058979..4060210,4060266..4062126,4062304..4062460,4062675..4064834,4064920..4070984,4071035..4071278,4071333..4071662,4073538..4073641,4075253..4075527,4075626..4076710,4077177..4077289,4077395..4077563,4078024..4078123,4079525..4079716,4081936..4082292,4082402..4082666,4083014..4083300,4083824..4083945,4084065..4084468,4085025..4085225,4086656..4087183,4087457..4087778,4088154..4088938,4089295..4089623,4089682..4089900,4089947..4090186,4090328..4090427)
Genome map
AA seq 8081 aa AA seqDB search
MASRRQKQFDRKYSSYRKFTATEDVNYSTHSSRSSYRSESLTSRTDGRGRSTSSEIIAGS
ESRSYPVYIAIQDYTPDKEDVEAIPLEQGQIVEVLDKKNSVRWLVRTKARPPRSGWVPGS
YFETPTEFYKQRRRTREIENVSLSDEQAALVKRDQVYHELLRSEEEFVSSLRTCVDDYIK
VLDDPEVPEAVKKNREELTLNIPELYNFHANVMLKGLNYYSDDPGKVGQTFVRLEKDFES
HVEFYKQYADTLKLLEEPEIKRFFEGLSAKNDAGASSFVDHVKEIADRMVQYQNYFKEFV
KYSARAHGSSKSIQKALELVTTIPQRVHDLEFTNNLKQHPGDTGKLGRIIRHDAFQVWEG
DEPPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHTTDEDTIVLQPQEP
GLPSFRIKPKDFETSEYVRKAWLRDIAEEQEKYAAERDAISMTATSEMTASSVDFDMNAS
DQQSEFSEWSGSRKSSLFPGPEEGGPPRKKVKSPPVISPTGSSTSIYSGGSSSIDWTTTG
TTLEMQGTRVTRTQYGFRTLQESSAKMCLKVTGYPLPDITWYKDDVQLHEDERHTFYSDE
DGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECK
EGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTV
KIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII
WFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVP
PAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFY
RISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTG
EFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQYAGTVLCRAE
NAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLK
GEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAP
EFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGAS
ILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKESVVVEKQDLSSSEVQKEI
AQQVKEASPEATTTITMETSLTSTKTTTMSTTEVTSTVGGVTVETKESESESATTVIGGG
SGGVTEGSISVSKIEVVSKTDSQTDVREGTPKRRVSFAEEELPKEVIDSDRKKKKSPSPD
KKEKSPEKTEEKPASPTKKTGEEVKSPKEKSPASPTKKEKSPAAEEVKSPTKKEKSPSSP
TKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSS
ETTIEKTETTMTTEMTHESEESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIKSP
VKKEKSPEKVEEKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPK
EKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKT
DDEVKSPTKKEKSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKK
EKSPEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEK
VEEKPASPTKKEKTPEKSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKSPT
PKKSPPGSPKKKKSKSPEAEKPPAPKLTRDLKLQTVNKTDLAHFEVVVEHATECKWFLDG
KEITTAQGVTVSKDDQFEFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETK
KPEFTDKLRDMEVTKGDTVQMDVIALHSPLYKWYQNGNLLEDGKNGVTIKNEENKSSLII
PNAQDSGKITVEASNEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISG
FPAPTVKWTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQA
DLKVEPNVKAPKFKSQLTDKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQV
VDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHET
TLEESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGT
IRVEAENVSGKVQATAQLKVDKKTEVPKFTTNMDDRQVKEGEDVKFTANVEGYPEPSVAW
TLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKVG
DAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVEEEDGSL
KLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRPMAKPAFQSDIAPINLTEGDTL
ECKLLITGDPTPFVKWYIGTQLVCATEDTEISNANGVYTMKIHGVTADMTGKIKCVAYNK
AGEVSTEGPLKVVAPIPVEFETSLCDATCREGDTLKLRAVLLGEPEPVVSWYVNGKKLEE
SQNIKIHSEKGTYTVTIKDITCDYSGQVVCEAINEYGKATSEATLLVLPRGEPPDFLEWL
SNVRARTGTKVVHKVVFTGDPKPSLTWYINNKEILNSDLYTIVTDDKTSTLTINSFNPDV
HVGEIICKAENDAGEVSCTANMITYTSDMFSESESEAQAEEFVGDDLTEDESLREEMHRT
PTPVMAPKFITKIKDTKAKKGHSAVFECVVPDTKGVCCKWLKDGKEIELIARIRVQTRTG
PEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIESLEKKSEKKAPEFIVAL
QDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESITVESVEGVERVTITSSELSHQ
GKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDF
YSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTS
KITTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGSAPDVEWFKDDKPVSEDGNHEMKKNP
ETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN
ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYAC
RATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD
DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI
PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHT
LTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELV
VRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKA
GKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFF
KNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAA
KVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKV
KGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAW
TEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEEL
KPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGF
FKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDS
KTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQGTKILLSVEVEGKP
KTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATV
TVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDLG
NGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTTVKQGETAT
FNVKVKGPVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDA
DSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQVKWYKNGKEIP
NAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIAIVKGLEDA
EVPKGKKAVLQVETNKKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAE
YKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKW
YKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVE
PKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQL
VIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFE
VKIQGEPEDVRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGK
AKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEA
KKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVE
EPQPVELKVKVEGIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAY
RVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFP
EVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVT
VTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFLNGIPIKFDDRITLD
DMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRFN
VPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF
EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPI
RLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATN
AHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKW
YRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMA
LGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSR
FEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQP
PRFTLKMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLL
IPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEP
LENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATR
QDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGD
SVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVA
TNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC
ATGIPTPTVKWYKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKL
GSAKTEGSLNIIRPRHIADADERGGMPFPPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPE
VEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDV
TVPFLDSIKFNGEIDVTPYLTEEYGFKKLNTASLPTPPDRGPFIKEVTGHYLTLSWIPTK
RAPPRYPQVTYVIEIRELPEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISD
PSPASPPSRLMAPPQPVFDRRTNKVIPLLDPYAEKALDMRYSEQYACAPWFSPGVVEKRY
CAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKEN
VGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKW
MKEWRPIVESSRIKFVQDGPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAE
GDYNDVELPRRRVTIESRRVRELYEISEKDEKLAAEGAPFRVKEKATGREFLAQLRPIDD
ALMRHVDIHNSLDHPGIVQMHRVLRDEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGV
NRETCVRVFVRQLLLALKHMHDLRIAHLDLRPETILLQDDKLKLADFGQARRLLRGLITG
EIKGSPEFVSPEIVRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSCQFD
SSPLGNFSYDAGDFVKKLLTEIPVSRLTVDEALDHPWINDEKLKTEPLSADTLREFKYQH
KWLERRVFVQQTPSEQILEAILGPATAQAQQNAPVAPEGRRPAEIYDYLRIQPKKPPPTV
EYVPQPRKEHPPFIDEFGQLIDGDAFDRPEGTGFEGPHRQPPQIPPQPQRPNQAAHDSRR
HEQQPQHQGQPQRIPVDQYGRPLVDPRYLNDPSHRPSSLDDAPFYVDKYGNPVHFDKYGR
PMAPQNLEKRKLIPQDKGETPSHSKKEKTQHPVATPILASPGGDQQQQKIPMRMIRGERR
EIEEEIANRILSDISEEGSIAGSLASLEDFEIPKDFQVEASEPSTPTLTPEVTIRETIPK
PTPSPTSPQKSPVPQPQGLLIPAKVTYSDSILAGLPAADKKVLEDAENDPSIPVGAPLFL
EGLHGSDLTIDTTSASGLIKVTSPAINLSPNPKSPRRSTPGTKSPVVLSPRQEHSMEVLI
ATKRGKPGFLPPGELAEDIDDEDAFMDDRKKQVKPKDHDGENDFKDEKERLEKDKNRRTV
NLDDLDKYRPSAFYKDDSDFGHPGYDIDATPWDSHYQIGPDTYLMAARGAAFNSRVRNYR
EELFGMGAPTVKQGFLGVRNRDITVRERRRYTDILRETTQGLEPKSHEQSTALLQKAPSA
TAIERIKADIEKVTPCATKKNDDGTFAPIFTARLRDVYLRKNQPAIFECAVSASPAPKVT
WDFQGKILESNDRVTIEQDNNVARLILNHAAPYDLGEYVCTAINEYGTDKSSCRLISGET
PSRPGRPEAELSSDTEIFIQWEAPEGPTYLEGITYRLEYRVAGPNDHGDPWITVSEKIDD
ESVIVKHLSPLGIYQFRVTAQNGFGLGLPSLSSRIVQTHGKGAPKLQIDVLKSEIRLNVV
SMPQKSTNQLGGISEESEEDSEARTANEDMKSNLQLQTDDPTGRFQIGGLKFKGRFSVIR
DAVDSTTEGHAHCAVKIRHPSSEAISEYESLRDGQHENVQRLIAAFNNSNFLYLLSERLY
EDVFSRFVFNDYYTEEQVALTMRQVTSALHFLHFKGIAHLDVNPHNIMFQSKRSWVVKLV
DFGRAQKVSGAVKPVDFDTKWASPEFHIPETPVTVQSDMWGMGVVTFCLLAGFHPFTSEY
DREEEIKENVINVKCDPNLIPVNASQECLSFATWALKKSPVRRMRTDEALSHKFLSSDPS
MVRRRESIKYSASRLRKLAAMIRQPTFSQPISEELESKYGK
NT seq 24246 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcgacgccaaaagcagttcgatcggaagtacagctcctatcgaaaattcact
gcaaccgaagatgtcaactacagtacccactcgtcaagatcatcctatcgatctgaatca
ttgacttcgagaaccgatggacgcgggcggtccacgtcatccgaaatcattgccggatcg
gaatcccgatcttatccagtgtacattgcgattcaagactacactcctgacaaagaagac
gtggaagcgattcccttagaacaaggtcaaattgtcgaggtgctcgacaagaagaactcg
gttcgatggcttgttagaacaaaggcacgtccaccacgttccggttgggttccgggatcg
tactttgaaactccgaccgagttttacaagcaaagaagacgaacgagagaaattgagaac
gtcagtctgtctgatgaacaggcggctcttgtcaagagagaccaagtctaccatgagctg
ctccgttccgaagaggaattcgtctcatctcttcgaacttgcgtcgatgattacatcaaa
gttctcgatgatcccgaagtaccagaagccgtcaaaaagaaccgcgaagagcttactctc
aacattccagagctctataatttccacgccaatgtgatgctgaaaggcctcaactattat
tctgacgatccgggcaaggtcggtcagacttttgtccgtcttgaaaaagactttgagagc
cacgtggagttctataagcagtacgcagatacactgaaattgcttgaagaacctgaaatt
aagagattctttgagggtctctccgcaaaaaatgacgctggagcatcctcattcgtcgac
catgtcaaagagatcgccgatcgaatggtccaatatcaaaattattttaaagagtttgtc
aagtattctgcaagagcacacggttcatcaaaaagtattcaaaaggcgctggaattggtc
accactattccgcaaagagttcacgatctagaattcaccaataatttgaagcaacatcca
ggagatactggaaagttgggacggattatcagacatgacgctttccaagtgtgggaagga
gatgagccaccgaaacttcgctacgtgttcctgttccgaaataaaataatgttcacggaa
caagatgcatcgacaagtccaccaagttatacacattattcatcaattcgattggacaaa
tacaatatcagacaacacacgacagacgaggatactattgtccttcaacctcaggaaccg
ggacttccaagtttcagaatcaaaccaaaggactttgaaacttcggagtacgtgcgcaaa
gcctggctgagggacatcgcagaggagcaggagaaatatgctgctgaacgagatgcgatc
tcgatgacggcaacgtcagagatgaccgcatcctcggtcgatttcgatatgaacgcgtcg
gaccagcaatccgaattttcggaatggtccggctcccgaaagagcagcttgttccctggt
ccagaagaaggaggtccaccacgaaagaaggtaaaatcaccgccggtgatttcacctacc
ggctcgtccaccagtatctattcaggaggaagtagtagtattgattggacaacaactgga
acgacactcgaaatgcaaggaacgcgtgtaaccagaacccaatacggtttcagaaccttg
caagaatcatcagcgaaaatgtgtctgaaagtaactggatatccattacctgatatcaca
tggtacaaagatgatgtacaacttcatgaagatgagagacacactttttattcggatgaa
gatggtttctttgcgatgaccattgatccagttcaggtgaccgacactggtcgttacaca
tgtatggcaacaaacgaatacggtcaggcatccacttctgcctttttccgagttttgaaa
gtcgaaaaagaagctgctccaccagcatttgtcacaaaactcagagacaaagaatgcaaa
gaaggtgatgttattgatttcgaatgtgaagttgaaggatggcctgaaccggaacttgta
tggcttgtcgacgatcagccactccgaccatcccacgactttcggctgcaatatgatgga
cagacggcaaagctcgaaattcgtgatgctcagccggatgatactggagtctatacagtc
aagattcaaaatgagttcggatcgattgaaagcaaggctgagctctttgttcaagcagat
ccagataagaaccatgtggctccagagttccaggcaacaattgaatatgttgagtgtgat
gagggagaggaagttcgattcaagtcagttattactggagatcctaatccagaaatcatt
tggttcatcaatggaaaaccactgagtgaatcagaaaaagtcaagttcatctcggaagat
ggaatctgcatcttaacgattaaagacgtaaccaggcatttcgatggaatggttacatgt
caaggatcaaacagattgggttcagcgtcttgtgatggaaggctaaaagtcagagttcca
ccagcaccaccaacctttaataagccactcgaagataagacagtccaggagaagagtact
gttgtgttcgaagtggatgtcagcggatggccagagccaacactaaccttcacactttgc
ggaaaagagttgaaaaacggtgaagaaggcgttgaaatcgtagggcacgacggtttctat
cgcatttcgatcccgaacacatcgatggacaagcacgacggtgaaattgtggcaaaggct
caaaatgagcatggaaccgcggagagtagggcacggctcactgtggaacaggaggaggag
gagtcgcgcagtgcgccgactttcttgaaggatattgaagatcaaaccgtaaaaaccggc
gagttcgccgtcttcgagacaaccgttcgcggaaatccgaatccggaggttacttggttc
atcaacgggcacaagatggatcagggcagtccgggcgtcaagatcgaggcgcacaatcac
gaccataagctgactatcgactcggcacagtacgcgggcaccgtactctgcagagctgaa
aatgctgttggacgattcgaaacgaaagcccgactcgttgttctggccccagaaaaacag
aagaaaccaccgaaattcgtggagattcttgtcgacaaaaccgaaaccgtcgacaacaca
gttgtgtttgaagttcgcgttgaaggtgaaccaaaaccgactgtaacatggtatttaaaa
ggagaagaactcaaacaatcggatcgcgtcgagattcgagaattcgatggatcaataaaa
atctcaatcaagaacatcaaaattgaagatgccggagagatcagggctgttgcgacaaac
tctgaaggatctgatgagacgaaggcgaaattgactgttcagaagaagccattcgctcca
gaatttgatttgcgaccagttagcttgacagtcgaaaagggatccgaagcagttttcagt
gcacacgcttttggtattccattgccaacttatgaatggtctgtcaatggaagaaaggtg
cgagatggacaggaaggggcgcgcgtaacacgtgacgagagcaccgtcgacggcgcatcg
atcctgacgatcgacacggcgacatactattccgaagtgaaccatctgacaatttctgtt
gtcgcagaaaacacactcggagccgaagagacgggcgcccagttgacgatcgagccgaag
aaggagagtgtcgtcgtcgaaaagcaagatttgtccagttcagaagtccagaaggaaata
gctcagcaggtaaaagaagcttctcctgaggcaacaacaaccatcacaatggagacatcg
ttgacgtcaactaaaacaactacaatgtccacaactgaagtcacatcaacagttggagga
gtgactgtcgagaccaaggagtcggaatcggaatccgcgacaacagtgatcggaggagga
tcaggtggtgtaaccgagggaagcatcagtgttagcaagattgaggttgtctcgaagacg
gactcacagactgatgttagagaaggaacaccaaagagacgagtgtcgtttgctgaagag
gaattgccaaaagaggttattgattcggaccgcaaaaagaagaagagtccaagcccggac
aaaaaggagaagagccctgagaaaactgaggaaaagcctgctagtcctactaagaagact
ggtgaggaggtgaagtctccaaaggagaagagcccagcaagtccgacaaagaaggaaaag
tcacctgcagcagaggaagttaaatcacctaccaaaaaggagaaatctccatcatcacca
accaagaaggaaaagagcccatcgtctccaaccaaaaagactggggatgaggtgaaagaa
aagtctccaccaaagagcccaaccaaaaaggaaaagagcccggagaaacctgaagatgta
aaatctccagttaagaaggaaaaaagcccggatgcaactaatattgttgaagtttcctct
gaaacaacaattgagaaaactgaaactactatgaccactgagatgacacacgaatcggaa
gagtcaagaacttccgtgaaaaaggagaagactccggagaaggttgatgaaaaaccaaag
agcccgacgaagaaggacaaatcaccagaaaagtctattaccgaggagatcaagtcacct
gtcaaaaaagagaaatctccggagaaggtggaagagaaaccagctagtcctaccaagaaa
gagaagtctccagaaaaaccagcttcgccgacaaagaagtcggaaaatgaagtaaaatct
ccaactaaaaaagagaagagtccagagaaatctgtagttgaagagctaaaatctccaaag
gaaaaatcaccagagaaggctgacgacaagccaaagagcccgacaaagaaggagaagtca
cctgaaaaatcggctacggaagatgtgaaatctccaaccaaaaaagaaaaatctccagaa
aaagttgaagagaagccaacgagcccaaccaaaaaagagtcctcgccaactaaaaagacc
gatgatgaggtaaagtctccaaccaagaaggagaagagcccacaaaccgttgaagaaaaa
ccagctagcccgacaaagaaggagaagtcgccagagaaatctgtagtagaagaggtgaaa
tctcccaaagaaaaatctccagaaaaggctgaggagaagccaaagagtcctacaaagaaa
gagaagtcacctgaaaagtccgctgcggaagaagtcaaatctcctaccaaaaaagagaag
tctccagaaaagtctgctgaggagaagcctaagagcccaaccaaaaaagagtcttcacca
gttaaaatggcagatgatgaggtgaaatctccaaccaagaaggaaaagagccccgaaaag
gttgaagaaaaacctgcgagcccaaccaagaaagaaaaaacaccagaaaagtcagctgcc
gaagaactcaaatctcccacgaagaaggaaaagagcccatcttcaccaaccaagaaaact
ggggacgaatccaaagaaaaatctccagaaaaaccagaggagaagccaaagagcccgaca
ccaaagaagtctccaccaggctcaccaaagaagaagaagtcaaagtcgccggaagccgaa
aagcctccagcgccaaagctcactcgcgacctcaaattgcagacagtcaacaagaccgac
ttggcccatttcgaagttgtcgttgaacatgcaaccgagtgcaaatggttcttggatgga
aaagagattacgacagcccaaggggttacggtttcaaaggacgatcaatttgaattccgt
tgctcaattgatacaaccatgtttggaagtggaactgtgtctgttgtggcttcaaatgct
gctggttccgtggagactaagactgaattgaaggttttggaaactccaaaggaaaccaag
aaaccagaattcactgacaagctcagagatatggaagtcacaaagggagatacagtacag
atggacgtcatcgccctacactcgcctctatacaaatggtaccaaaatggaaatctgttg
gaagatggaaagaatggagttaccattaagaacgaggaaaacaaatcttcattgatcatt
ccaaatgctcaagattctggaaagatcacagttgaagcttcgaacgaagtcggatcatct
gaatcctctgctcaactgactgtcaatccaccatcaactaccccaattgttgttgatgga
ccaaagtcggtgactatcaaggaaacggaaactgctgagttcaaggcaacaattagcgga
ttcccagcaccaactgtcaaatggacgattaatgaaaagatcgtagaggaatctagaact
atcaccactatcaagacggaagacgtctatactttgaagatctctaatgcaaagatcgag
cagactggaactgtgaaagttactgctcaaaattcagctggacaggatagcaagcaagct
gaccttaaggttgaaccaaatgtgaaagctccaaagttcaagtctcagctcactgataag
gttgctgatgaaggagaaccactccgttggaatcttgaattggatgggccatcacctgga
actgaagtctcttggcttcttaacggacagccacttacaaagagtgatactgttcaagta
gtcgatcatggagatggaacttatcatgtgacgattgcagaggccaagccagaaatgtct
ggaactcttacagcaaaagcaaagaacgccgcaggagagtgtgagacatcggcaaaggtt
actgtgaatggaggaaacaagaaaccagaatttgttcaagctccacaaaatcacgagaca
actcttgaagaaagtgttaagttcagcgctattgttactggaaaaccaatgccaaatgtg
acatggtatttgaacaacaagaagttgatccagagtgaggaggttaaagtgaagtatgtt
catgagactggaaagacatcaatccgcattcaaaagccactcatggagcacaatggaact
atccgcgttgaagctgagaatgtgtcaggaaaggttcaagccacagctcaattgaaggtt
gacaaaaagactgaagttccaaagttcactacgaacatggatgatcgtcaagtcaaagag
ggagaagatgtgaagttcactgcaaatgtggaaggataccctgaaccatctgtagcatgg
actttgaatggagaaccagtttctaagcatccaaacatcactgttaccgacaaggacgga
gagcacaccatcgaaatttccgccgtcacacccgaacaagctggagagctgtcttgcgaa
gcgacaaaccccgtcggatccaaaaagagagatgttcaactcgctgttaaaaaggtcggt
gatgcaccaacgtttgcaaagaatctcgaagatcggttgatcaccgagggagagttgaca
ttgatggatgctaaattaaacattgtaaaaccaaagccaaagatcacctggcttaaggat
ggtgttgaaattacttctgatgggcattataagattgttgaagaggaagatggatccttg
aaacttagcattcttcaaactaaactggaagataagggaagaatcacgattaaagcggaa
agcgaatttggcgttgcggaatgttcagcatctcttggagttgttaagggacgcccaatg
gccaaaccagcattccaaagtgatattgcaccaattaacctcaccgaaggagataccctt
gaatgcaagcttctcatcaccggagacccaacacctttcgtcaagtggtacattggaaca
caactcgtttgtgccactgaagatactgagatctctaatgccaatggagtttacactatg
aagattcatggtgtgactgctgacatgactggaaagatcaagtgcgtcgcatacaataag
gctggagaagtgagcaccgagggtccactcaaggttgttgcaccgattccggttgaattt
gaaacatctctatgtgatgctacctgcagagaaggagatactctcaaattgagggcagta
ttgctcggagagccagaaccagttgtctcgtggtatgtgaacggaaagaagttggaagaa
tctcagaatatcaagattcattctgagaaaggaacatacacggttacaatcaaagacatc
acatgcgattattctggacaagtcgtctgcgaggcaatcaacgagtatggaaaagcaaca
tctgaggctacattgctcgtgctgccacgtggtgaacctccagatttcttggaatggctc
agcaatgttcgcgcaagaactggaaccaaggtcgtgcacaaggttgtcttcacaggagac
ccgaaaccaagccttacatggtacatcaataataaggagattctcaactcggatctttac
accatcgtcacagatgataaaacatcaacgttgacaatcaacagcttcaacccagatgtt
catgttggagaaattatctgcaaggccgagaacgatgctggagaagtttcctgtaccgca
aacatgatcacctacacatctgacatgttcagtgaatctgaaagtgaagcccaagctgaa
gaatttgtcggagacgatctcactgaagatgagagtcttcgagaggaaatgcaccgtact
ccaactccagttatggcacccaaattcatcacaaagatcaaggataccaaagccaagaag
ggacactctgctgtctttgaatgcgttgttccagacaccaagggagtgtgctgcaagtgg
ttgaaggacggaaaagagattgagctgattgccagaatccgggttcaaactagaactgga
ccagagggacacatcactcaagaacttgtcctcgacaacgtcactccagaagatgccggc
aagtacacgtgcatcgttgagaacaccgccggaaaagatacctgtgaggcgacgctaact
gtcattgaatcattggagaagaagtcggagaaaaaagctccagaattcattgttgctctt
caagataagacaacaaagacatccgagaaggttgttcttgaatgcaaagtcatcggagag
ccaaagccgaaagtcagctggcttcacgataataagacaattactcaagagtctatcaca
gttgaatcagtggaaggcgtcgaaagagtcacaatcacttcatctgaattgtctcatcaa
ggaaaatacacctgcattgccgagaacactgaaggaacatctaagactgaagcattcttg
actgtccaaggcgaagctccagtgttcacaaaggaactgcagaacaaggagttatcaatt
ggagagaagctcgttctctcgtgttctgtcaaaggatccccacagccgcatgtcgatttt
tattcgttctcggaaactacgaaggtggagacgaagatcacctcatccagtcgaatcgcc
attgagcatgaccagaccaatacgcattggagaatggttatcagtcaaatcacaaaagaa
gatattgtctcctacaaagctattgccacaaattcaattggaactgctacttcaacatca
aagatcaccacgaaggtagaggcaccagtctttgagcaaggattaaagaagacaagtgtg
aaggagaaggaagaaattaagatggaagtaaaggtcggaggaagtgctccagatgttgaa
tggtttaaggatgacaaaccagtcagtgaagatggaaatcatgagatgaagaagaatcca
gaaactggagtgtttactctggttgtgaaacaagctgcaactacagatgctggaaagtat
accgccaaggcttccaatccagcaggtactgctgaatcttctgcagaggctgaggtcact
caatctctcgagaaaccaactttcgtgagggaacttgtcacaactgaagtcaagatcaat
gaaactgcaactttgtccgttacagtgaaaggagttccagatccgagtgttgaatggctt
aaggatggacaaccagtgcaaactgattcaagtcatgtgattgctaaggttgaaggatcc
ggaagctactcgattaccattaaggatgcgagactcgaggactctggaaagtacgcatgc
cgtgcaaccaatccagcaggtgaagccaaaactgaggctaactttgcagttgtcaagaac
ttggttccaccagaatttgttgagaaactcagtccactcgaagtgaaggagaaggaaagt
accaccttgtccgtcaaggttgtaggaacaccagaaccatctgttgaatggttcaaggat
gatactccaattagtatcgacaatgttcatgtcattcagaagcagacagctgttggatcc
ttcagtttaaccatcaatgacgcgagacagggagatgttggaatctactcttgccgtgct
aggaatgaagctggggaagctcttacaacagcgaactttggaatcatcagggattctatt
ccaccagagtttactcaaaaacttcgaccacttgaagtcagagagcaggagactcttgat
ttgaaagttactgtaattggaaccccagtaccaaatgttgaatggttcaaggatgataag
ccaatcaatattgataactcgcacatttttgcaaaggatgaaggatcaggacatcatact
ctcacaattaaacaagctagaggagaagatgttggagtctacacctgcaaagccaccaac
gaagccggagaagccaaaaccactgcaaacatggctgttcaagaagagattgaagcacca
ttgtttgttcaaggcctgaaaccatacgaggtggaacaaggcaagccagctgaattggtg
gttcgtgtagaaggaaagccagagcctgaggttaaatggttcaaggatggagttccgatt
gctattgacaatcagcatgtgattgagaagaagggagagaatggatctcatactcttgtc
atcaaagacaccaacaatgctgacttcggaaagtacacatgccaagctacaaacaaggct
ggaaaggatgaaactgttggagagctcaagattccaaagtattcattcgaaaagcaaact
gctgaagaagtcaagccactgttcattgagccactaaaggaaacatttgccgttgaagga
gataccgttgttcttgaatgcaaggtgaacaaggaatcacatccacaaatcaagttcttc
aagaatgatcaaccagtggagattggacaacacatgcaattggaagtattggaagatgga
aatatcaagctcacaattcaaaatgccaagaaagaagacgttggtgcatatcgttgcgag
gctgtgaatgttgccggaaaggccaacacgaatgctgatttgaagattcaattcgctgct
aaagttgaagaacatgtcaccgatgaaagtggccagcttgaggagattggacagtttgag
actgtcggagatactgcatcctctaagaccgacactggacgtggagctccagaatttgtg
gagcttctccgttcgtgtacagttaccgagaagcaacaagcgatccttaagtgcaaggtg
aaaggagagccacgaccaaagatcaagtggactaaggaaggaaaggaggtcgaaatgtcg
gcacgtgttcgcgctgagcacaaggatgatggaactttgacgctgacatttgataatgtt
actcaagccgacgccggagaatacagatgtgaggctgagaacgagtatggaagtgcatgg
accgaagggccaattattgtcacattggaaggagctccaaagattgacggtgaagctcca
gacttcttgcaaccagtcaagccagctgttgttacagttggtgagactgcagttcttgaa
ggaaagatttctggaaaaccgaaaccaagtgttaaatggtacaagaatggagaagagctc
aagccatccgatagagttaagattgagaatttggatgatggaactcaaagactcaccgtt
accaacgctaaactcgacgatatggatgagtaccgctgtgaagcttcaaatgagtttgga
gatgtttggagtgacgtcactcttacagtcaaggaaccagctcaagttgctccaggattc
ttcaaggaactctctgctattcaggttaaggagactgaaaccgccaagtttgaatgcaag
gtttcgggaactaagccagatgtgaaatggttcaaggacggaactccattgaaggaagac
aaacgagtgcacttcgaatcaaccgacgatggaactcaaagacttgtcatcgaagattcc
aagactgatgatcaaggaaactaccgtattgaagtttccaatgatgctggagttgcgaac
agcaaggttccactcacagtcgttccatcagaaaccctcaagatcaagaagggactcaca
gatgtaaatgttacacagggaaccaagatccttctctctgttgaagttgaaggaaaacca
aaaactgtcaaatggtacaagggaacagaaactgtcaccagctcccagaccacaaagatc
gtgcaggtgaccgagtcagaatacaagttagaaatcgaaagcgctgagatgtctgatact
ggagcttaccgcgttgttctctctactgattcgttttctgttgagtcgtctgctacagta
actgtcaccaaggctgctgaaaagattagtcttccttcattcaagaagggactcgctgat
caatccgttccaaagggaactccattggttttggaagttgaaatcgaaggaaagccaaaa
gatgttaaatggtataagaatggagatgagatcaaggacgggaaggtcgaggatcttgga
aacggaaaataccgactcacaattccagacttccaagagaaagatgttggagagtacagt
gtcactgctgctaacgaggctggagaaattgaatcaaaggccaaggtaaacgtgagtgcc
aagcctgaaattgtttctgggctggtaccaactactgtgaagcaaggagaaactgccacc
tttaacgtcaaggtcaagggaccagtcaagggagtcaagtggtacaagaacggaaaagag
attcctgatgctaaaacaaaggacaatggagatggatcctactctcttgagattccaaac
gctcaagttgaagatgcagctgactataaggttgttgtctccaatgatgctggagatgct
gattcttcagctgctcttaccgtcaaacttgctgacgatggaaaggataaggtgaaacca
gaaattgtatcgggacttattccaactacagtgaagcaaggagaaactgccacctttaac
gtcaaggtcaagggtccagtgaaacaggtcaagtggtataagaatggaaaagaaattccc
aacgccaaggctaaggacaacggagatggatcctactctctggaaattccaaacgcgcaa
cttgatgacactgccgactacaaggttgttgtgtcgaatgatgctggagatgctgattct
tcagctgctcttactgttaagcttcctggaatcgctattgttaagggacttgaagacgcc
gaagtgccaaagggcaagaaggctgttctccaagttgaaaccaacaagaagccaaaggaa
attaaatggtataagaatggaaaggagattactccaagcgacaaggcacaacccggaagc
gacggagacaacaaaccacagctggttattccagatgctggtgacgatgatgctgctgaa
tataaggttgtgttgactgatgaagatggaaatactgccgattcgtcatgcgccttgact
gttaaattaccagcaaaagagccaaagatcatcaaaggactcgaggatcaagtggtgtcg
attggatctccaattaagttggaaatcgaaacttctggatcaccgaagactgtgaaatgg
tacaaaaacggaaaggagcttccaggagctgccgccaagaccatcaagattcagaagatc
gacgataacaagtatgttcttgagatcccatccagtgttgttgaagataccggagactac
aaagtcgaagttgccaacgaggcaggatctgcaaacagcagtggaaagatcactgtggaa
ccaaagatcacgttcttaaagccactgaaggatcaatcgatcactgagggagaaaatgcc
gaattctcagttgaaaccaacaccaagccaagaattgtcaaatggtataagaatggacaa
gaaattaagccaaattcccgattcatcattgaacaaaagactgataccaagtatcaactt
gttattaagaacgctgttcgtgatgatgcagacacctacaagattgttcttgaaaacacc
gctggagaagccgaatcttctgctcaattgactgttaagaaagctaaggctggactctgc
aagatcgtcaaaggtcttgaagaccaggttgttgccaagggtgccaagatggtatttgag
gttaagatccaaggagagccagaggatgtcagatggcttcgtgatgcaaatgttatcagt
gcaggagctaatgcaatcattgagaaaattgatgacaccacctacaggttgataattcca
tccgctgatttgaaggatgctggtgaatacactgtcgaagtaatcaatgagagtggaaaa
gccaagagtgatgcaaagggagaggttgatgagaaaccagagattgttcgaggacttgag
aacatcgaaattccagagggagatgacgatgtgttcaaggttgaagtcagtgctccagtc
agacaagtcaaatggtataaaaatgaccaggagatcaaaccaaacagccatttggaagcc
aaaaagatcggtccaaagaagtacgaacttgctatcaaccgtgctcaattggacgatgga
gccgactacaaggttgtgctatcgaatgctgcaggagattgtgattcttccgcggctctc
actgttgtcaagccaaatgttctgaagattgtcgatggattgaaggatgttgatgttgag
gaaccccaaccagttgaacttaaggtcaaggttgagggtattccaaaggttattaaatgg
tacaagaacggacaggagcttaagccagatgctgacggattcaaatttgaagagaaacca
gaatctggagagttctctctcactatcccatcgtctaagaaatctgatgggggtgcatac
cgtgttgttcttggaaatgacaagggagaagtatacagtggatctgttgttcatgttaaa
tctgccaaatcatccgaaccaacatcaggagccaacttcctctccccactcaaggatacc
gaggttgaagaaggagatatgctcactcttcagtgcactattgctggagaaccattcccc
gaagtcatctgggagaaggatggtgttgtccttcagaaggatgatagaatcacgatgaga
gtcgcacttgatggtactgctaccctcagaattcgttctgccaagaagagtgacattgga
caatatcgtgttactgcgaagaacgaagctggaagcgctacaagtgactgcaaggttacc
gtcactgaacaaggagagcaaccatcgaagccaaagttcgttattccattgaagacggga
gcagctcttccaggcgacaagaaggaattcaatgtgaaggttcgaggacttccaaagcca
acattgcaatggttcttgaacggaatcccaatcaaattcgatgatagaatcaccctcgat
gacatggctgatggaaactactgtcttacgattcgtgacgttcgtgaagaagacttcgga
accttgaagtgtattgcaaagaatgagaatggaacagatgaaactgtctgtgaattccaa
caaggtgctggacacgatgatggatctagagacgatcttcgttatccaccaagattcaat
gttccactttgggacagaagaatccctgttggtgacccaatgttcatcgagtgtcatgtt
gatgccaacccgaccgccgaagttgaatggttcaaggatggaaagaagatcgaacacact
gcacataccgaaatcagaaacaccgttgatggagcatgtcgcatcaagatcattccattc
gaggagtctgatattggagtttacatgtgcgttgctgtaaacgagttgggacaagctgaa
actcaagccacataccaagttgagattttggaacatgtggaggaggagaagcgccgagaa
tatgctccaaagattaatccaccattggaagataaaactgtcaatggaggtcaaccaatc
agattatcatgcaaggttgacgctatcccaagagcttcagtggtttggtacaaggatgga
cttccacttcgtgctgattctagaacctctattcaatatgaagaggatggtacagctacc
cttgcgatcaatgacagtaccgaggaagacattggagcataccgttgtgttgctacaaat
gctcatggaacgatcaacaccagttgcagtgtgaacgtcaaggttccgaagcaggaagtc
aagaaggagggagaagagccattcttcacaaagggacttgtcgatttgtgggcggatcgt
ggagattcgttcactttgaagtgcgcagtcaccggagatccattcccagaaatcaagtgg
tacagaaatggacaacttcttagaaatggaccaagaactgttattgaaacatcgccagat
ggttcatgttcacttactgtcaatgaatctacaatgagtgatgaaggaatctatcgatgt
gaagctgaaaatgctcatggaaaggccaagactcaagctactgctcatgtgcaaatggct
cttggaaagactgaaaaaccaaaaatggatgaaggaaaaccaccaaagttcattttggag
ctttctgatatgtcagtttctcttggaaatgttattgatttggaatgcaaggttaccgga
ctaccaaatccatcagtcaaatggtcgaaggatggaggtccactgattgaggactccaga
ttcgaatggtccaatgaagccagcaagggagtctatcagctcagaatcaagaacgccacc
gtacatgacgagggaacttatcgctgcgttgccacaaatgagaatggaagtgctactacc
aagtcatttgtaagaatggatgatggtcttggatcaggtgttgtgactgccagtcagcca
ccaagattcactttgaagatgggagatgttcgtacaactgaaggacaaccattaaaattg
gagtgtaaggttgacgctagcccacttccagagatggtttggtataaggatggagccatt
gttacaccatctgacagaattcaaattagtctgtcacctgatggagttgcaactcttctt
atcccatcttgcgtctatgatgatgatggaatctaccgtgtaattgccaccaacccatct
ggaactgcccaggataagggaactgctactgttaagaaacttccaagagatagcggtgcc
agaaggtctgctgacagagatgtatttgatgctaacaaggcaccaaagcttatggagcca
ctggagaatatcagaattcccgaaaagcagtcgttccgtcttcgttgcaagttcagcgga
gatccaaagccaacaatcaaatggttcaaggatggagaacgtgtattcccatacggacgt
cttcaactcatcgagtctccagatggtgtctgtgagttggtggttgattctgccactcgt
caagatgctggaggatacagatgcgttgctgaaaacacttatggatctgctagaacatct
tgcgatgttaatgttattcgcggtgatcgtaagccacgcgacattgactcgtccattcgt
gaaggaaaggctccaggattcaccaccccattgacaatccgtcgtgctaagccaggagat
tccgtgacattcgaatgccttccattcggaaatccattcccatcaatcaagtggcttaag
gatggacttgagctgttctctgatgaaaagatcaagatggaagctgctgcagatggaacc
cagcgactcattctttccgatgtcaccttcttgagtgaaggatacttcagatgtgtagct
accaatgagcatggaactgcttctacaaaggctgaacttgtcatcgaaggagaccgaact
attggatcccgcccacttccagaagtaaacggagagcctgaagaatgcaagccaagaatc
cgtcgtggactgtacaacatgagtattcacgagggtaatgttgtggagatgatcgtctgt
gcaactggtatcccaacgccaactgtcaagtggtacaaggatggacaggagattgtcgga
gatggacctgatggaaagagggtcatctttacggatgaacgaggaattcatcacttggtt
attgtgaatgcatctccagatgatgaaggagagtactcgttggaagcaacgaataagttg
ggatcagccaagaccgaaggatccttgaacattatcagaccaagacatattgcagatgct
gacgagagaggaggcatgccattcccaccaggattcgtgcgtcaactaaagaacaagcac
gtcttcaatcacatgccaacaatcttcgactgccttgttgtcggacacccagcccctgaa
gtagagtggttccacaatggaaagaagattgttccaggaggacgaatcaagattcaatcg
tgtggaggaggatctcatgccctcatcattctcgatacaacccttgaagatgcaggagag
tacgttgctactgcgaagaactctcatggatccgccagctcatcagcagtgcttgatgtg
actgttccattcctggacagcatcaagttcaatggagagattgatgtgactccatacctc
accgaggaatatggattcaagaagcttaacaccgccagtctcccaactccaccagatcgt
ggaccattcatcaaggaggtcaccggacattatcttacactctcatggattccaacaaag
agagctccaccacgttatccacaagtcacatatgttattgagattcgtgaacttccagag
aaacaatggtctctcttggagtataacattccagagccagtatgcaaggttcgtaatttg
gaactcggaaagtcatatcaattccgtgttcgtgctgagaacatctatggaatctctgat
ccatcgccagcatctccaccatcaagactcatggctccaccacaaccagtattcgataga
agaacgaacaaagttattccacttcttgacccatatgcagaaaaagctcttgatatgaga
tactctgaacagtacgcgtgtgctccatggttctcaccaggagtcgttgagaagcgatac
tgcgccgagaacgataccctcacaattgttctgaatgtgtccggattcccggatccagat
atcaaatggaagttccgtggatgggatattgacacgtcatcgccaacctctaaatgcaaa
gtgtacacttatggaggttccgagacaacattagccatcactggattcagcaaggagaat
gttggacaatatcaatgtttcgccaagaacgattacggagatgcacaacaaaatattatg
gttgatcttgcaacacgaccaaacttcatccaaccactcgtgaacaagaccttctcatca
gctcagccaatgagaatggacgtgagagtcgacggagaacctttcccagaattgaaatgg
atgaaggaatggcgcccaattgtcgagtcgtctcgcatcaagtttgttcaagacggacct
tatttgtgctctttgatcattaatgatccaatgtggagagactccggaatctattcatgt
gttgctgtaaatgatgccggacaagccacgacgtcgtgtactgttactgttgaagctgaa
ggcgactacaatgacgtcgaacttccccgtcgccgagtgacaatcgaatcgcgacgagtg
cgagagctctacgaaatctctgaaaaagacgaaaagttggcggccgaaggagcaccattt
cgagtcaaagaaaaagccacgggacgcgagtttttggcgcagttgagaccgatcgatgat
gctctaatgcgccacgtggatatccacaattcgttggatcatccaggaattgtgcaaatg
catcgggtgcttagagatgagaaattggcattggtggtgtttgataatgcaaactcaact
atcgacggcctctcaagccttgcgcaccctggcgtcgaaattgctgagccaaaaggagtc
aaccgtgaaacatgtgttcgtgtctttgttcgtcaacttcttcttgctctcaagcacatg
catgatttgcgaattgcccatctagatctccgtcccgaaaccattcttcttcaagatgat
aagctgaaattagcagacttcggtcaagcaagacgccttctacgcggccttatcaccgga
gaaatcaagggatcgcccgagttcgtgagccctgaaatcgtgagaagttacccattgacc
ctggcaactgatatgtggagtactggagttttgacatatgtattactaaccggattgtca
ccattccacggagataatgacaatgagacccttgcaaacgttgatagttgccaatttgat
tcgtctcctcttggcaacttctcctatgacgccggagatttcgtcaagaaactgttgacc
gagattccagtctcacgtttgacagttgatgaagcattagaccatccatggattaacgat
gaaaagctgaaaactgaacctttgtcagctgacacgttgagggaattcaaatatcagcat
aagtggctggaacgtcgcgtgttcgttcaacagacgccgtccgaacagattcttgaagca
attcttggtccggcaacggcacaagctcaacaaaatgctcctgtagcaccggaaggtcga
cgtcctgctgaaatttacgactatctgagaattcagccgaaaaagccaccaccgactgtg
gaatacgttccacaacctagaaaagagcatccgccgtttattgacgaattcggacaactt
attgacggagacgcttttgatcgaccagagggtactggatttgaaggaccacatagacaa
ccaccacaaattccacctcaacctcaacgaccgaaccaggcagctcacgattcgagacga
cacgaacaacaaccacaacatcaggggcaaccacagcgaattcctgttgatcaatacggt
cgtccgctagtcgacccacgttacctgaacgatccatcgcaccgcccgagttcccttgac
gacgctccattctacgtggacaaatacggaaatccggtgcactttgacaaatacggtaga
ccaatggctccacaaaacttggaaaagcgaaagcttatcccacaagacaaaggagaaacc
ccatctcattccaaaaaagaaaagactcagcatccagttgctacaccgattctagcatcg
ccgggaggagatcaacagcagcagaagatcccgatgagaatgatccgtggggaacgaaga
gaaatcgaagaggaaattgcgaatagaatattatcagatatttctgaagaaggatcaatt
gctggttcacttgccagtttggaagattttgagattcccaaggatttccaagtagaggca
tctgagccatcaacaccaactctcacaccagaagtaacaatcagagagactattccaaag
ccaacaccatctccaacatccccacagaaatctccagttccacaaccacaaggtctcttg
attccagcaaaggtcacctactctgactcaatactcgccggactccctgcagcagataaa
aaggtcctcgaagacgcggaaaacgatccatccatcccagtcggtgctccacttttcctt
gaaggactccacggatctgatcttacaatcgacacgacctcagcttcaggactgatcaaa
gtcacatccccagctatcaacctcagtccaaatccaaaatctccacgccgttccactcca
ggtacaaagagtccagttgtgttgagtccacgtcaagagcactcaatggaagtattgatc
gcaacaaagcgaggaaaacctggattcttgccaccaggagaacttgctgaagatattgat
gatgaggatgcatttatggatgacagaaagaaacaagtgaaaccaaaggatcatgatgga
gaaaatgatttcaaagatgagaaagaaagactggagaaggacaaaaacagaagaactgtt
aacttggatgatcttgataaatatcgtccaagtgcattctacaaagatgatagtgatttc
ggacatcctggatatgatattgatgcaactccatgggactcacattatcagattggtcca
gacacttatctgatggctgctcgtggagccgccttcaactcccgagtccgtaactatcgt
gaggaactcttcggaatgggggctccaactgtcaaacagggattcctcggagtcagaaat
cgtgacattactgttcgtgaacgtcgtcgttacactgatatcctccgcgagactacacaa
ggccttgagccaaaatctcatgagcaatcaacagctcttcttcaaaaagctccatcagca
acagcaattgagagaattaaggctgatattgagaaggtcacgccgtgtgccacaaagaag
aatgatgatggaacctttgccccaatcttcactgcccgtctccgtgatgtgtatcttcgt
aaaaaccaaccagcaattttcgaatgcgctgtttcagccagcccggctccaaaagttact
tgggacttccaagggaagattctagagtctaacgacagggttacaatcgaacaagataac
aatgtcgcccgtcttatccttaaccatgcagctccttacgatcttggagaatacgtgtgc
actgccataaatgaatatggaacagataaatcaagttgccgactgataagtggagagact
ccatctcgtccaggaagacctgaagctgaactctcatctgatacggagattttcattcaa
tgggaagctccagaaggaccaacatatctggaaggtatcacctacagactcgaatatcgt
gttgcaggaccgaatgatcatggtgacccatggatcactgtttctgaaaagattgatgat
gaatctgtaattgttaaacatctatcaccacttggaatttatcaattccgagtcactgca
cagaatggattcggtctagggctcccatcattgagtagcagaattgttcaaactcacgga
aaaggagcaccaaagttgcaaattgatgttttgaaatccgagattcgactgaatgttgtt
tcaatgcctcaaaagtctacaaatcaattaggaggaatttcggaggaaagtgaagaggat
tcggaggcaagaacggcaaatgaagatatgaaatcaaatctgcaattgcaaactgatgat
ccaacaggacggttccagatcggtggtctcaagttcaagggacgtttctctgtgatccgc
gacgccgtcgattccacaacagaaggtcacgcccattgcgctgtgaagattcgtcatcca
tcgtctgaagcgatctcagagtatgaatcgcttcgtgatggtcagcatgaaaatgttcaa
cgccttatcgccgcattcaataactccaatttcttgtatctattatcggaaagactctac
gaagatgtgttttctcgttttgtgttcaacgattattatacagaagaacaagttgcattg
acaatgagacaagtcacttcggcacttcatttcttgcatttcaaaggaattgcccatctt
gatgtgaatccacacaacataatgttccaatcaaaacgtagttgggtcgtgaaactagtt
gattttggaagagcacaaaaagtgtcgggagctgtgaaaccagttgattttgatactaaa
tgggcttcaccagaattccatattccggaaactccggttaccgttcaaagtgacatgtgg
ggtatgggagtcgtcactttctgccttctcgctggattccacccgttcacttctgaatac
gaccgcgaagaggagatcaaggagaacgtgatcaatgtgaaatgtgatccaaatttgatt
ccagtcaacgcttcccaagaatgcctttcatttgccacgtgggcgctcaaaaagtcgcca
gttcgccgaatgagaaccgacgaggctctttctcataagttcctttcttcagatccatcg
atggttagaaggagggaatctattaaatactctgcatcaagactccgaaagcttgccgca
atgatccgccagccaacattcagccaaccaatcagcgaagagctcgagtcgaaatatgga
aaataa

DBGET integrated database retrieval system