KEGG   Caenorhabditis elegans (nematode): CELE_F43D9.2
Entry
CELE_F43D9.2      CDS       T00019                                 

Gene name
rab-33
Definition
(RefSeq) Ras-related protein Rab-33
  KO
K07920  Ras-related protein Rab-33B
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_F43D9.2 (rab-33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F43D9.2 (rab-33)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F43D9.2 (rab-33)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_F43D9.2 (rab-33)
Membrane trafficking [BR:cel04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab GTPases
    CELE_F43D9.2 (rab-33)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    CELE_F43D9.2 (rab-33)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CELE_F43D9.2 (rab-33)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab33
    CELE_F43D9.2 (rab-33)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 G-alpha
Other DBs
NCBI-GeneID: 176470
NCBI-ProteinID: NP_499314
WormBase: WBGene00004283
Ensembl: WBGene00004283
UniProt: Q20365
Position
III:complement(join(10500574..10500798,10501380..10501524,10502252..10502499,10503288..10503491,10503750..10503851))
AA seq 307 aa
MSEHHVNIPAPQFSTYATVIDPPKHVTATHPDELTTASHPQPTHPSAPQDPSPAVPSTPV
RVPYPTAPPPIPPAPEAVTAGPKKMALAPSSTKTYKQKRTFKVIIVGNAAVGKTCLSFRF
CCGRFPEHTEATIGVDFRERSCVIENELLRVQLWDTAGQERYRQSIVAHYYRNVNAVVFV
YDVTCRESFNDLALWIKECEKHGLVGDSEVPRILIGNKCDVECTNRVSTDEAQMFADRNN
MALFETSAKLASEADHVESIFLTLLHKLQQSKPMHVQSQDERHQKEQERLILKANETENV
EEEGFCC
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtcggagcatcatgtgaacatcccggctcctcagttctccacgtatgctactgtaatt
gatccaccgaaacatgtcactgcaactcatcctgatgagctgacaacagcatcacatccc
caaccaacacatccatcagcaccacaagatccttcaccagcagtaccatcaactccagtt
cgtgttccatatccaacagctcctccaccaatacctccggctccagaagcagtgacagct
gggccgaagaaaatggcgttggctccgtcttcaacgaaaacatacaaacagaagagaact
ttcaaggtaatcatagtgggcaacgcggccgtcggaaaaacgtgtctttcattccgtttt
tgttgtggaagattccccgaacatactgaagccacaatcggagtggattttcgagaaaga
agttgtgtaattgaaaatgaacttcttcgtgttcagctatgggatactgctggacaggaa
agatatcgacaatcgattgttgctcattattatagaaatgtgaatgctgtcgtttttgtg
tatgatgtcacatgccgtgagtcattcaacgatttggcactttggataaaagaatgtgaa
aagcatggtctcgttggggatagtgaagttccgaggatcctgatcggcaacaagtgtgac
gtggaatgcacaaatcgagtgtccactgatgaagctcagatgttcgccgaccgtaacaac
atggcattattcgaaacatcagccaaattagcatcagaagcagatcatgtcgaatcaatt
tttctcacactgttacacaaactacaacaaagtaaaccaatgcacgtacaatcacaagat
gaacgacatcaaaaagagcaagaacggttgattttgaaggcaaatgagacggaaaatgtg
gaagaagagggattctgctgctga

DBGET integrated database retrieval system