KEGG   Caenorhabditis elegans (nematode): CELE_F55C7.7Help
Entry
CELE_F55C7.7      CDS       T00019                                 

Gene name
unc-73
Definition
(RefSeq) Uncharacterized protein
  KO
K08810  triple functional domain protein [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F55C7.7 (unc-73)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F55C7.7 (unc-73)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_F55C7.7 (unc-73)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CAMK group
  Trio family [OT]
   CELE_F55C7.7 (unc-73)
Membrane trafficking [BR:cel04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    CELE_F55C7.7 (unc-73)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RhoGEF I-set PH PH_13 Ig_3 SH3_1 fn3
Motif
Other DBs
NCBI-GeneID: 171988
NCBI-ProteinID: NP_001021496
WormBase: WBGene00006805
Ensembl: WBGene00006805
UniProt: O61528
Position
I:complement(join(3999348..3999523,3999587..3999691,3999776..3999908,3999956..4000017,4000337..4000542,4000676..4000803,4001431..4001502,4002343..4002508,4002597..4002832,4002892..4003149,4003270..4004088,4004481..4004604,4010774..4010852,4015941..4016043,4016885..4016971,4021229..4021750,4021954..4022344,4022391..4022501,4022549..4022796,4023299..4023554,4023650..4023751,4024278..4025277,4025460..4025837,4025886..4026126,4026417..4026800,4026867..4026941,4026989..4027199,4027768..4027871,4027999..4028403,4028790..4028883,4029059..4029228,4031607..4031627))
Genome map
AA seq 2488 aa AA seqDB search
MGDYDGKMTMKAEDILHVLRDGIAVLPGGRCRAGQAVIVCPSREQPVNQDNLRNVFLYLF
EVTSKMAREKGFLVVIDMRGKQTWTNVRHILKALSSIESSSTVQVFIIKPEKFWEKQKAQ
MSLGTWDFEVEMISFESLIKIIDSSHLPKTVGGSYPYDHDEWLELRLDLEKWIWNITEIM
EKLESVRREICEGEQPVDVTTANAALKKSQHAKNSIFNVPVEGIETEGNKIATRILKPSK
GVKNPDLEATTPYISNLTDSLRLLKGEVAKNWEVRQMELSKVYQQKQFERDAEHMIETLR
PYKKACERSMGDVGGCANDVVRLSAEFEQFQIAVRGMEVSVKQVFDKENHLRTIGARNQI
TDHVAARLAEEWHLVKELMERRSAVLHNAKEFFTSAQRYFAEVPRWTAQPGVNPNDVLFN
QESLEEAIRKHDAFWAQVEEVYAQAYDDASKVTRALKEADAEDNVAREHSSRLQRAHKQL
MEKWKERQVLLHHMLAMIAFETDVRLVVDWLEQHGEPYLRRNIHIGENVNQARSFQRNHT
NFQRVAANTYGNVQKLHQVYQDVTKSGSKICDVDTMHGLMTDLSAKIEKFTKIENSRELL
LRQSVLFHTHYKELTDWYGKMGEKYKDRRIDLTVPTCDKNKERFVLETDETAQAYAMTID
EGKTLIEMMQRATRVFDVDYSASVAHIQLLISDIEDKNTQISSEWSPRRTLLHIASKFAM
FEQNQFEVLEQIKSWEVDMREMAESDSFYDKADSVLPFHKDNQQQVRNAIADIQKSAKEL
SQALYSQKLTDLRDKRDRVVLEAIREHVRELEIAESRVMTYANETSMRMQAASEVGDLRR
ISNSVCKLIDNQLSALTQLGVIPNDYNDTVQKQEELRAFRDAVQHKLKEPYDAFVIRFRE
LMENRLANRDEVVYHNEAIQAKYCRLMNLCEDRNKLLKSAHGCYKTYETAVLPILNQLES
EYHSPTVTDWCAGCTSSIDADRAAYVADLLSKHMDYKERFGKGCTYALRNGDFLLRYIRR
STVNQSERKRHETKIADMKNNIRERQSNILELWMQKKLLLEGCQSFIFIEASAKELLEFM
KGEGNRKLKHFEKKGRRESTDDDDEFAKFKSEVKQKKTDIQTFLMLSTNETMSRGVHGDE
IDRCIEQVKDEFSRFSRRVGDCEVVLRGENGSTQSSKDEFSLDRHSDTAIFNEKKINERR
EENRKMLEPMRELIQSERDYIKDLERCVNIYVKEFDQAAKNGTIPTLNPLKYEIFGNIEK
IFKFHNDKLLHELIKYENQPEAVGASFIVWIDLLNELYTEYCVNKEQKNHVIATPDAVSF
FTGIRERHGLEINNEIASLLIKPVQRITRYRLLIEQLMRSCTDKTNDLKEAYEVVCSVPR
KVNDLIHYNCLDLKDFKVDELGPFVTQDTLTFWEPRAYFKGRGKERQVFLFDISIVFAKR
IEVSPKNIKYVIKGKPLPLSEVSIVEHVEGDTCRFGLRVGTVSSNDNRIDLKANNHHTKV
KWVQKIRDLTAGMLPLGLGVSEAYSVGTLSTARSVSVRSGASTSSGGENRQSQDVESLLR
HRYSVHSCDSEQSSEVWIVTADFDGQVEGHLTVHKGDRVEIVEDQATDCAEYVQVVLCDQ
PTKHGLVPASIIAPPESGSVPDRPDDSNASGSTVSKRKSLRRIFANSSKERAAAANSSSS
NNNSPATRQSTSTSSPVTANGHTTESSTSAPIGVLSSGEPTSSNSIPSSSTPTHTVPSSV
PATVIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEK
TPEETARFKRSYVLMELVETEQDYVKDLTSVVEGYIGNLNKMDLPADLVGKDKIIFANIV
NILEFHKTNFLKEIEKCSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQDDFEA
FFADTKAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVV
PKACDDMMQVGRLQNFDKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIA
DHIPPKKEFGNPTYIFKSQFMVNKMVFEPNVPDDPLRFVIKSSDPTQPTSFIANAQSQEE
KDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLSLGAPGGDRRGAPSSANRSAAS
SSKKPAESPKKEGKSKSSLFSFGKKPAKSPTSPPPLDAAAAGKFQKVADDQVNLETDEKV
KVLDVKNGYASVKKADGTVGKCPSYFLTMSDIPGTNFAEQIQYRREWQRRVDETDVEYGP
SAFDTATSSTDNFDVLLELTTCERPVVVEDMKDIEVVEGNDVEMCPIISSHTDFTVIWHG
PAVDSKRARIQTNQLNSRLLIKHVKKCDAGAYSVIAKNSFGVTSTVAFLSVISIPDPPTD
FTVKISGDHEVRLKWKAESGLKYCIEYRILDDSSPENWLIASTNIEKTHVSLRNFARNSY
SFRVFAYNQRVRSAPSQCICICFDGTEM
NT seq 7467 nt NT seq  +upstreamnt  +downstreamnt
atgggcgattatgatggaaaaatgacgatgaaagcagaagacattctgcatgttcttcgt
gacggcattgcagtacttcctggaggacgatgtagagccggacaagcagttatcgtatgt
ccatcacgagagcaacctgtcaatcaggataatttacgcaatgtctttctgtatttattt
gaagttacttcgaagatggcacgcgaaaagggattccttgtggtaattgatatgcgtgga
aaacaaacatggaccaatgttcgacacattctgaaagctctcagtagtattgaaagctca
tcaacagtacaagtgttcatcatcaagcccgaaaaattctgggagaaacaaaaagcacaa
atgtcccttggaacgtgggattttgaagttgaaatgatctcattcgaatcgcttatcaaa
ataatcgactcgtcacatttaccgaaaaccgtcggcggaagctatccatatgatcatgat
gaatggcttgagctcaggttggatctcgagaaatggatctggaatatcactgaaattatg
gaaaagctcgagtctgtacgtcgagaaatttgcgaaggcgagcagcctgtcgatgtgaca
actgccaacgctgcgctgaaaaagagccaacacgcaaagaatagtatatttaatgttccg
gtggaaggaattgagacagaagggaataaaattgcaactcgaatattaaaaccgtcgaag
ggtgtcaaaaacccggaccttgaagcgacaaccccatatatttcaaatttgaccgattcg
ctcaggttgctcaaaggcgaagtagccaagaattgggaagttcgacagatggaactttca
aaagtgtaccagcagaaacaatttgaacgtgacgcagaacatatgattgagacgcttcgg
ccgtacaaaaaagcctgtgaacgtagtatgggtgatgttggtggttgtgcaaacgatgtc
gttcggctctctgcggagtttgagcagttccagattgctgtgagaggtatggaagtgtct
gtgaaacaagttttcgacaaggaaaatcatttgagaactattggagcccggaatcagatt
accgatcacgtggcggcacgacttgccgaagaatggcacctagtcaaagaactcatggag
aggcggagtgcagttttgcacaatgccaaagaattctttacgtcagctcaacgatatttc
gcagaagtacccagatggactgcacaacccggagtaaatccaaacgatgtgctcttcaat
caggagtcgttggaagaagccattcgaaaacatgacgcattttgggctcaagttgaagag
gtttatgcgcaagcttatgatgatgcgtcaaaagtgacaagagctctgaaagaagctgat
gctgaagataatgttgctagggagcattcgagtagactgcaaagggcacataagcagttg
atggaaaagtggaaagaaagacaggttctgctccatcatatgcttgcaatgattgcgttt
gaaaccgacgtgaggttagtcgtcgattggctcgaacaacacggtgaaccgtatcttcga
cgtaacattcatattggtgaaaacgtgaatcaggcgagaagcttccagaggaatcacaca
aattttcaacgggttgctgcgaatacctatggtaacgtgcaaaagcttcatcaagtctat
caggatgtgactaaatctggcagtaaaatctgcgacgttgacactatgcacggtctcatg
acggatctatcggcaaaaattgagaagttcacgaagatcgagaactctcgggagctgctg
ctacggcaatcggttctttttcacactcactataaagagttgacggattggtatggaaaa
atgggcgagaagtataaggatcggaggatagatctgacggttccaacttgtgataagaat
aaggaacgatttgtgttggagactgacgagactgctcaagcatacgccatgacaatagac
gaagggaagacgctgatcgaaatgatgcagagagctacacgggtttttgatgttgattac
tcggctagtgttgcacacattcaactgcttatctcagatattgaagacaagaacacacag
atctcatcagaatggtctccacgacgaactctcctacacatcgcctcaaagtttgccatg
ttcgaacagaatcagtttgaagtgttggaacagatcaaaagttgggaagttgatatgcga
gaaatggcagaatctgactcattttacgacaaggctgattcggttttaccattccataaa
gataaccaacaacaagttcgcaacgcgatcgcggacattcaaaaatctgcaaaagagcta
tcgcaagctttgtatagtcaaaagttgacggatcttcgggacaaacgggatagagtggtg
ctcgaagcaatacgagagcatgttcgagaacttgaaattgccgaatcccgagtgatgacg
tacgcgaatgaaacttcaatgagaatgcaagcagcttcggaagtcggtgatctcagaagg
atatccaatagtgtttgtaagcttattgataatcaattatcagccctcacgcagctagga
gtcattccaaatgactataatgatactgtgcaaaagcaagaagagttgagagcttttcgt
gatgcagttcaacataagctcaaggaaccgtatgacgcatttgttataagatttcgagag
ctgatggaaaatcggctggcgaatcgagatgaagtagtctaccacaatgaagcaattcaa
gctaaatactgtcgactcatgaatctttgtgaagatcggaataagttactaaaatccgca
catggatgctacaagacctatgagacagcagtgcttccaatactcaatcagttggagtct
gaatatcactctccgacggttacggattggtgtgcaggatgtacatcttcgatcgacgcc
gatcgagcagcttatgtggcagatctgctcagcaagcacatggactataaagaacgattc
ggtaaaggatgtacgtatgcgctgagaaacggtgactttctgctacgttatattcgaaga
tcgacggtgaaccaaagtgaacggaagcgacatgaaacgaagattgctgacatgaagaac
aatattcgagaacgacaatcgaatattctcgagctatggatgcagaaaaaattgttgttg
gaaggatgtcagtccttcattttcatagaagccagtgcgaaagaacttttggaatttatg
aaaggcgaaggtaatcgaaagttgaagcattttgagaagaagggtcgtcgagagtcaacc
gatgatgacgatgaattcgcaaagttcaaatctgaagtgaagcagaagaagacggatatt
cagacgttcttaatgctgagcacaaatgaaactatgagccgaggggttcacggagacgaa
attgataggtgtattgagcaggtgaaagatgagttcagtcgattctcacgacgtgttggg
gactgtgaagttgtattgagaggggaaaatggatcaacgcagtcgtcgaaagacgaattc
tcacttgatcgacactcggatactgccatattcaatgagaagaagatcaatgaacgacgt
gaggagaatcgaaagatgcttgagccaatgcgagagcttattcaatccgaacgggattat
atcaaagatctcgagagatgtgttaacatatacgtcaaggaatttgatcaagctgcgaag
aatggaacaattccgacgttgaatccgctgaaatatgaaattttcggaaacattgagaag
attttcaagtttcataatgacaaacttcttcatgagcttatcaagtatgagaatcaacca
gaagctgttggtgcatcgtttatagtttggattgatttgctcaatgagctctacacggaa
tattgcgtgaacaaggagcagaagaaccatgtcatcgcgacacccgacgccgtttcgttt
ttcaccggtatccgagaacgacacggattggagatcaataacgagattgcgagtctcttg
ataaagcctgttcagagaataacacgctatcgtctgttgattgagcaattgatgagaagt
tgtacggataagacgaatgatctcaaagaggcgtacgaagtggtgtgcagtgtgcctaga
aaagtgaacgatctcattcattacaactgtttggatttgaaggatttcaaggttgatgag
cttggaccatttgtcactcaagacactttgacgttctgggagccacgagcctactttaag
ggacgaggaaaagagcgtcaagtattcttattcgatatttcgattgttttcgctaaacgc
attgaagtttcaccgaaaaatatcaaatatgtgatcaaaggaaagccccttccactaagc
gaagtgtcaattgtggagcacgtcgaaggcgacacttgccgattcggtcttcgtgttgga
actgtgtcgtcgaacgataatcgcattgatttgaaggccaacaatcatcatacaaaagtg
aaatgggttcagaaaatccgtgatctaacagctggaatgttgccattgggtcttggagta
tcggaggcttactcagttggaacactatcgacagcccgtagtgtctcagtgcgatcaggt
gcatccacgtcgtctggtggtgagaatcgacaatcacaggatgtcgagtcacttttacgc
catcgatacagtgttcacagttgtgatagtgagcagtcatcggaggtctggatcgtgacg
gcagattttgatggacaagtcgaagggcatttgactgtgcataaaggggatcgagttgag
attgtggaagaccaagccaccgattgtgccgaatacgtgcaagtggtactgtgtgatcag
ccaacgaaacacggactcgtacccgcctccataattgctccacccgaatctggaagtgta
cctgaccgcccagacgactcgaatgcctcgggatcgacggtgtcgaagcgaaaatcgttg
cgacgaatcttcgccaactccagcaaggagcgggccgcagcagcaaactcgtcgtcgtca
aacaacaacagcccggcaacgaggcagtcgacgtctacatcatctccagtcactgccaac
ggacatactactgaatcgtcaacttctgcaccaattggagtactttcatctggagaacca
acatcatcgaactcgattccatcttcatcgacaccaacacataccgtcccgtcttcagtc
cccgcaacagtcattccgatcgttgttgcagaagacgagaaggccgaggattgcctaccc
ccaccgatggaaaatatcaccatcaacaatagcatcgacgagaaggacatgaacgaggat
tcggtagcagcatcagacgccgttgagccggaagtcgctttacctgcaaaggtggagaag
acgccggaagagacggctcgattcaagagatcatatgtgctgatggagctcgtcgagact
gagcaggattatgtgaaagacttgacgtcggttgtcgaaggctatattgggaatttgaac
aagatggatcttccagctgatctcgtcggaaaggacaaaatcattttcgcgaatatagtc
aatattcttgagttccacaaaacaaacttcctgaaagagattgaaaagtgttccgagaat
tacgaagccgccggagccgcgtttgtcaagtacgagagacggttacacactctgtacgtg
acgtactgtcaaaacaagccaaaatccgactatcttttggcgcaagatgattttgaggca
ttcttcgcagacacaaaagcaaaattaggacacaaggtagcgctgtgcgacttgcttatc
aagccggtgcagcgaatcatgaaatatcaattgttgctcaaggatattctcaagttcacc
gaacgagcaaaggataagaccgatacgcttaagaaagcgttacaggtgatgcatgttgtt
ccaaaagcctgtgatgacatgatgcaagtcggtcgtctgcaaaactttgacaaaagtctc
tcagctcaaggcaaacttattcatcagggaacactgcagatcagtgaatcgatagccgga
aacgtacaaaaaccgaaagatcgacgaattttcttgtttgagcagtcggcgatcatcgca
gatcacattccgccgaagaaggagttcggaaatcccacgtacatttttaagagtcaattt
atggtaaacaaaatggtgttcgagccaaatgtgccggatgatccgcttcgattcgtcatc
aagagctccgatccaacacagccgacaagcttcattgcgaatgcacaatcacaagaggag
aaggacgaatggaatcgcaaaatgagcgagctactcgatcaacaaaaacgattgctcgca
gctcttgtggatccgagacgatacaacgatatgtccagcggaatgggagatctgagttta
ggtgcccctggaggtgacaggagaggcgctccatcatcagcaaacagatcagcagcatca
tcatcgaaaaagccagcagaatctccgaaaaaagagggaaaatcaaaatcgtcgctgttc
tcgtttggaaagaaaccggcgaaatcgccgacctctccgccaccgttggacgcggctgca
gccggcaaattccagaaggttgctgatgatcaagtaaatctagagacggatgaaaaggtt
aaagtgctagatgtgaaaaatggatatgcaagtgtgaagaaagccgacggtactgttggg
aagtgtcccagctactttttgacaatgtcagacataccaggaacaaattttgcggaacaa
attcaatatcgtcgagaatggcaacgtagagtggatgagacggacgttgaatacggtcct
agtgcatttgatactgccacgtcatcaacggacaattttgacgttcttctggagttgacg
acatgtgagagaccagttgtggttgaggatatgaaagatattgaagttgtcgagggaaat
gatgttgaaatgtgtccgattatttcttcgcatacagacttcaccgtaatatggcatgga
ccagcggttgactcaaaacgagctagaatccagacaaatcaactgaacagtcgacttttg
attaaacacgtaaaaaagtgtgatgccggtgcttattcagtaatagcaaaaaactcattt
ggagtgacgtccactgtcgcatttctcagtgttatttcaattccagatcctccaaccgat
tttaccgtgaaaataagcggtgatcatgaggttcgcctaaaatggaaagcggaatcaggc
ttgaagtactgcattgagtaccgtattttggacgactcatctccagaaaattggctaatc
gcgtcgacgaacattgagaaaacacatgtttcactgcgaaattttgctcgaaacagttat
tcattccgagtttttgcatataatcaacgggtcaggagtgcaccatcacagtgtatttgt
atctgttttgatggaacggaaatgtga

DBGET integrated database retrieval system