KEGG   Caenorhabditis elegans (nematode): CELE_T25G12.4
Entry
CELE_T25G12.4     CDS       T00019                                 

Gene name
rab-6.2
Definition
(RefSeq) Ras-related protein Rab-6.2
  KO
K07893  Ras-related protein Rab-6A
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_T25G12.4 (rab-6.2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T25G12.4 (rab-6.2)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_T25G12.4 (rab-6.2)
Membrane trafficking [BR:cel04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    CELE_T25G12.4 (rab-6.2)
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
    CELE_T25G12.4 (rab-6.2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CELE_T25G12.4 (rab-6.2)
  Exosomal proteins of bladder cancer cells
   CELE_T25G12.4 (rab-6.2)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    CELE_T25G12.4 (rab-6.2)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA FeoB_N TetR_C_16
Other DBs
NCBI-GeneID: 181759
NCBI-ProteinID: NP_510790
WormBase: WBGene00004270
Ensembl: WBGene00004270
UniProt: Q22782
Position
X:join(17222479..17222539,17222600..17222712,17222765..17222870,17223197..17223308,17223900..17224054,17224104..17224174)
AA seq 205 aa
MSDFGNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVR
LQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIML
VGNKTDLSDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALPGIIKDDPV
EPPNVVTMDPIRQRQIVTDEGSCWC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtcggactttggtaatccgttgaagaaattcaagcttgtgttcctcggggaacaaagt
gtcggaaaaacctccctaatcactcgcttcatgtacgactccttcgacaacacctaccag
gccaccatcggaatcgacttcctgagtaagaccatgtacttggaggaccgaaccgttcgt
cttcaactttgggacaccgctggacaggaacgtttccgctcactcatcccatcctacatc
cgtgattctacagttgctgttgtggtttatgacatcaccaactccaactctttccatcaa
acttccaagtggattgacgacgtccgtactgagcgtggaagtgatgtaatcatcatgttg
gtcggcaacaagaccgatctttccgataagaggcaagtcaccaccgacgaaggagagaga
aaggccaaggagcttaatgtgatgttcatcgagacttctgccaaggccggctacaatgtg
aagcagcttttccgtcgtatcgccggagccctaccaggaatcatcaaggacgacccagtg
gagccaccaaatgtggtcacgatggacccaatccgtcagcgtcaaattgtcaccgacgag
ggatcgtgctggtgctaa

DBGET integrated database retrieval system