KEGG   Caenorhabditis elegans (nematode): CELE_Y54E10BR.2
Entry
CELE_Y54E10BR.2   CDS       T00019                                 

Gene name
Y54E10BR.2
Definition
(RefSeq) Uncharacterized protein
  KO
K07952  ADP-ribosylation factor related protein 1
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y54E10BR.2 (Y54E10BR.2)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cel04031]
    CELE_Y54E10BR.2 (Y54E10BR.2)
Membrane trafficking [BR:cel04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    CELE_Y54E10BR.2 (Y54E10BR.2)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arp
    CELE_Y54E10BR.2 (Y54E10BR.2)
SSDB
Motif
Pfam: Arf Ras Roc G-alpha SRPRB MMR_HSR1 Gtr1_RagA GTP_EFTU FeoB_N
Other DBs
NCBI-GeneID: 171878
NCBI-ProteinID: NP_491094
WormBase: WBGene00021841
Ensembl: WBGene00021841
UniProt: Q9N3C8
Position
I:join(3033006..3033098,3033155..3033242,3033296..3033460,3033530..3033621,3033687..3033824)
AA seq 191 aa
MYTLSAGIWEKFFKKKDYYVVIVGLDNAGKTTFLEQTKSHFVKDYGVLNPSKITATVGLN
TGNVELNNTCLHFWDLGGQESLRELWATYYDDANAMIFVVDATRSDLFPIVASQFKEVMA
NEIVQNIPVLVAVNKSEMEGAAAAAEVRMLLEDDNHRSDLAVLPVSALEGTNIERCVHWI
VRSLASQPLYL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtacacactttcggcgggtatctgggagaaattcttcaagaaaaaagactattatgtg
gtgatagtcggtctggataatgctggaaaaactacgtttctggagcaaacaaaatctcac
tttgtaaaggactacggggttctgaatccatcaaaaatcacggcgacagttggtttgaat
actggaaatgtcgagctcaacaacacatgtcttcatttctgggatctcggaggccaggag
agtttacgagaactctgggcgacatattacgacgatgcaaatgccatgatttttgttgtg
gacgcaacaaggagcgatctcttcccaatagtagcatctcagtttaaagaagtaatggcc
aacgaaatagttcaaaatattccagttttagtagcggtgaataaaagtgaaatggaagga
gccgccgctgccgctgaggtccgaatgctgctcgaagacgacaatcaccgctcggacctt
gcagttcttccggtttcggcgctagaaggaacaaatatcgaaagatgtgttcactggatc
gtccgatcgttggctagccagccattatacctttaa

DBGET integrated database retrieval system