KEGG   Caenorhabditis elegans (nematode): CELE_Y57G11C.13
Entry
CELE_Y57G11C.13   CDS       T00019                                 

Gene name
arl-8
Definition
(RefSeq) ARF-Like
  KO
K07955  ADP-ribosylation factor-like protein 8
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_Y57G11C.13 (arl-8)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cel04031]
    CELE_Y57G11C.13 (arl-8)
Membrane trafficking [BR:cel04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   Arf GTPases
    CELE_Y57G11C.13 (arl-8)
GTP-binding proteins [BR:cel04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl8
    CELE_Y57G11C.13 (arl-8)
SSDB
Motif
Pfam: Arf Ras Roc SRPRB G-alpha Gtr1_RagA MMR_HSR1 Dynamin_N GTP_EFTU AAA FeoB_N VirE
Other DBs
NCBI-GeneID: 178405
NCBI-ProteinID: NP_502791
WormBase: WBGene00000192
Ensembl: WBGene00000192
UniProt: G5EDC6
Position
IV:join(14798179..14798301,14798350..14798737,14798785..14798831)
AA seq 185 aa
MLAMVNKVLDWIRSLFWKEEMELTLVGLQNSGKTTFVNVIASGQFTEDMIPTVGFNMRKI
TKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADEEKLEASRNELMQLLDKPQL
DAIPVLVLGNKKDLPGALDERQLIERMNLSSIQNREICCYSISCKEKENIDITLQWLIDH
SKAQR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttggctatggtgaataaggttctcgactggattcgcagtcttttttggaaagaggag
atggagttgacacttgttgggctccaaaactctggaaaaacgacatttgtcaatgttatt
gctagcggccaattcacagaagatatgatcccaacagtcggattcaatatgcggaagatc
accaaaggcaacgtgacgatcaaattatgggatatcgggggccagccacggttccgctcg
atgtgggaacgatattgccgcggtgtcaacgccatcgtcttcatggtggacgctgccgac
gaggagaagctcgaagcatccagaaatgagcttatgcagctgttggacaagccacagctc
gacgctattccagttttggtgctcggaaacaagaaggatttgcctggagcacttgatgag
cggcaattgatcgaaagaatgaatctgtcatcaatccagaatcgcgagatttgctgctat
tctatttcatgcaaagagaaggagaatattgatatcaccctccaatggctcatcgatcac
tcgaaagctcaacgctaa

DBGET integrated database retrieval system