KEGG   Canis lupus familiaris (dog): 403941
Entry
403941            CDS       T01007                                 

Symbol
RAB5C
Name
(RefSeq) ras-related protein Rab-5C
  KO
K07889  Ras-related protein Rab-5C
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04014  Ras signaling pathway
cfa04144  Endocytosis
cfa04145  Phagosome
cfa04962  Vasopressin-regulated water reabsorption
cfa05132  Salmonella infection
cfa05146  Amoebiasis
cfa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    403941 (RAB5C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    403941 (RAB5C)
   04145 Phagosome
    403941 (RAB5C)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    403941 (RAB5C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    403941 (RAB5C)
   05152 Tuberculosis
    403941 (RAB5C)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    403941 (RAB5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    403941 (RAB5C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    403941 (RAB5C)
   04031 GTP-binding proteins [BR:cfa04031]
    403941 (RAB5C)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab GTPases
    403941 (RAB5C)
 Endosome - Lysosome transport
    403941 (RAB5C)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   403941 (RAB5C)
  Exosomal proteins of other body fluids (saliva and urine)
   403941 (RAB5C)
  Exosomal proteins of colorectal cancer cells
   403941 (RAB5C)
  Exosomal proteins of bladder cancer cells
   403941 (RAB5C)
GTP-binding proteins [BR:cfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    403941 (RAB5C)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_16
Other DBs
NCBI-GeneID: 403941
NCBI-ProteinID: NP_001003261
Ensembl: ENSCAFG00000015629
VGNC: 55798
UniProt: P51147
Position
9
AA seq 216 aa
MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT
QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ
RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK
KLPKNEPQNAAGAPSRNRGVDLQENSPASRSQCCSN
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcgggtcggggaggtgcagcgcgacccaatggaccagctgctgggaacaagatctgt
caattcaagctggtcctgctcggggaatctgcagtgggcaaatctagcctcgtccttcgc
ttcgtcaagggacagttccatgagtaccaggagagcacaattggagcggccttcctcaca
cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag
gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc
tatgacatcaccaacacagatacgtttgcacgggccaagaactgggtgaaggagctacag
aggcaggccagccccaacatcgtcattgcactcgcggggaacaaggcagacctggccagc
aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc
atggagacatccgcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag
aaacttcccaagaatgagccccagaatgcagctggtgccccgagccggaaccgaggggtg
gacctccaggagaacagcccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system