KEGG   Canis lupus familiaris (dog): 404009
Entry
404009            CDS       T01007                                 

Symbol
RAB2A
Name
(RefSeq) ras-related protein Rab-2A
  KO
K07877  Ras-related protein Rab-2A
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    404009 (RAB2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    404009 (RAB2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    404009 (RAB2A)
   04031 GTP-binding proteins [BR:cfa04031]
    404009 (RAB2A)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    404009 (RAB2A)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   404009 (RAB2A)
  Exosomal proteins of other body fluids (saliva and urine)
   404009 (RAB2A)
  Exosomal proteins of colorectal cancer cells
   404009 (RAB2A)
GTP-binding proteins [BR:cfa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    404009 (RAB2A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3
Other DBs
NCBI-GeneID: 404009
NCBI-ProteinID: NP_001003318
Ensembl: ENSCAFG00000007153
VGNC: 45271
UniProt: P61105
Position
29
AA seq 212 aa
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNATHAGNQGGQQAGGGCC
NT seq 639 nt   +upstreamnt  +downstreamnt
atggcgtacgcttatctcttcaagtacatcatcatcggcgacacaggtgttggtaaatca
tgcttattgctacagtttacagacaagaggtttcagccagtgcatgacctgactatcggt
gtagagtttggtgctcgaatgataactattgatgggaaacagataaaacttcagatatgg
gatacggcagggcaagagtcctttcgttccatcacaaggtcatattacagaggtgcagca
ggggctttactagtgtatgatattacaaggagagatacattcaaccacttgacaacctgg
ttagaagatgcccgccagcattccaattccaacatggtcattatgcttattggaaataaa
agtgatttagaatcaagaagagaagtaaaaaaagaagaaggtgaagcttttgcacgagaa
catggacttatcttcatggaaacttctgctaagactgcttccaatgtagaagaggcattt
attaatacagcaaaagaaatttatgagaaaatccaagaaggagtctttgacattaataat
gaggcaaacggcattaaaattggccctcagcacgctgctactaatgccacacacgcgggc
aatcagggaggacagcaggccgggggaggctgctgttga

DBGET integrated database retrieval system