KEGG   Citrobacter koseri: CKO_00880
Entry
CKO_00880         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
Organism
cko  Citrobacter koseri
SSDB
Motif
Pfam: TrwB_AAD_bind T4SS-DNA_transf DUF87 TraG-D_C AAA_10 FtsK_SpoIIIE AAA_22 DUF853 ABC_tran T2SSE DEAD
Other DBs
NCBI-ProteinID: ABV12030
UniProt: A8AEW7
Position
complement(870917..872671)
AA seq 584 aa
MELANMGSHLMQRLNAFADAFSFFLLWLQNSPVILSLFAGLTLPFIVNLPREERKNAPFW
LKSVACVSIFFFIFGTISPLTIQGLSYFFKLLDNNILFRIPLWIMTVTFTTAGLFFHIAA
RRLLAGEIDNLKHRMIKKTKLERNTRTDVRKVKELLPESIEYNPLDYIDLKKGAFIGLNK
NDQPQYITIKEFKTQHAAIIGTTGSGKSVTAAILLYQAILAGEAVFVEDPKDDEWAPHVL
REACKKAGKKFTLINLNKPNFQLDLLADISHEQLEELFNAGFSLAKKGEASDFYRISDRR
AARNTSAIYEKGMTLYDLFNTDFVQSLRQAAPAFFGELEEVALVNSINATNGFSLKEVFD
EGGCCYIIGSTRNQKIISAQRMILTRLIQIAETRDRINSTPRTVAIFLDELKYHLSRPAL
EGLGTARDKGVHIFMAFQAIDDLRDCPSDLNGDAVIGAIIENAKFKLIYKIQNPETAEWA
AKMTGSILVDDEMRKVRTDLSLTEKMDTDRMIRQAESYYVDSNMFLNLPEKVGFVFTTKE
LAKATKMSPILVKKKHIELLSFENPQSEQPQTEINEQNKPSINL
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggagttagcaaatatgggatcacatcttatgcaaaggctgaatgcttttgctgacgcc
ttttcctttttcctgttatggctgcaaaacagccctgtcatattatccctgttcgcaggt
cttacattaccgtttatagtcaaccttccccgagaggaaagaaagaacgctccgttctgg
ttaaaatcggtggcgtgtgtgtctattttcttttttatattcggtaccatatcaccgcta
actattcaggggctgagctacttttttaaattactcgacaacaacatactgttcagaatt
ccactatggatcatgacagtcacatttacgacagcaggattattctttcatattgcagcc
cgacgacttctggcgggagaaattgacaacctgaaacatcgaatgattaagaaaaccaag
ctggagagaaataccagaacggatgtacgtaaagtaaaagagctgttgcccgagagcata
gaatacaacccactcgattacattgatttaaagaaaggtgctttcattggcttaaacaaa
aatgaccagccgcaatacataaccataaaagaattcaagacccaacacgcagcaattatc
ggcacaactggttcagggaaaagtgtcactgcagccattctactttatcaggcaattctt
gcaggcgaggctgtttttgtagaagatccaaaagatgatgaatgggcaccacatgtactc
agggaagcatgtaaaaaagcgggcaagaaatttacacttataaatttgaacaagccaaat
tttcagcttgatttactggctgatatctctcatgaacaactggaggaactatttaacgct
ggctttagtctggctaaaaaaggggaagcttcagatttttatcgaatctctgaccgccgc
gcagccagaaatacatcagcaatttatgaaaaaggaatgacactttatgatttatttaac
actgattttgttcagtcattacgtcaagctgctcccgcattttttggtgagctggaagaa
gttgctttagttaactcaattaatgccacaaatggattttcattaaaggaggtttttgat
gaaggtggttgttgctacattattggttcaacacgaaatcaaaaaataatatccgcacaa
aggatgattctgacccgcctgatacaaatagcagagaccagggacagaataaacagcacc
ccgcgtactgttgctatttttctcgacgaattgaaatatcatctatcccgccccgccctt
gaggggcttggaacggcacgagataaaggcgtgcatatattcatggcttttcaggcgata
gacgatctgcgtgactgtccgtctgatttaaatggtgatgcagttattggagccatcatt
gaaaacgccaaattcaaattgatttataaaattcaaaatccagaaacagcagaatgggcg
gcaaaaatgacaggttcaatcctggtcgatgatgaaatgaggaaagtaaggactgattta
tcattaacggaaaaaatggatacagaccgtatgataagacaggcagaaagttactacgtt
gacagtaatatgtttttaaatctccctgaaaaggtcggctttgtatttacaacaaaagaa
ctggcgaaggcaacaaagatgtcccctattctggttaaaaagaaacatattgaattgctg
tcatttgaaaatcctcaatctgaacaaccacaaaccgaaatcaatgaacaaaataagcca
tctattaatttgtaa

DBGET integrated database retrieval system