KEGG   Cupriavidus necator N-1: CNE_1c27750
Entry
CNE_1c27750       CDS       T01564                                 
Name
(GenBank) hypothetical protein
Organism
cnc  Cupriavidus necator N-1
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE T2SSE ATPase_2 TrwB_AAD_bind AIG1 DUF87 AAA_16 AAA_10 AAA_7 DUF4913
Other DBs
NCBI-ProteinID: AEI78089
UniProt: G0ETP0
Position
1:complement(2878469..2881354)
AA seq 961 aa
MIRSFFRTRRAERATGASEPADEAWTRHVSLLAAHGITEPGSALAAGRRNPATEAQAQAL
YDVAPSFADLLPWVEYLPESMSMLLEDGDSVAAFFELAPVGTEGRELAWLWQARDALENA
LQDSFDELEEHPWVVQLYAQDEANWDGYLRTLADYVRPRAQGIAFSEFYLRFFAHHLRAI
AKPGGLFEDTMVTRLPWRGQVRRVRMVVYRRAPATAVSRRGQSPEQSLCTICDRLVGGLA
NAGVKARRMHAADIHDWLLRWFNPHPTLLGPSAEDCERFYALTRYPEEGETGEIELASGD
FAQRLFFGQPCSDVANGVWLFDGMPHRVIVMDRLRMPPATGHITGETRKGSDAVNALFDQ
MPEDTVMCLTLVATPQDVLEAHLNHLSKKSVGETLASEQTRQDVQQARSMIGSAHKLYRG
ALVFYLRGRDLQQLDARGLQLVNVMLNAGLQLVREEDEVAPLNSYLRWLPCVFDPALDKR
QWYTQLMFAQHAANLAPVWGRSQGTGHPGITFFNRGGGPITFDPLNRLDRQMNAHLFLFG
PTGSGKSATLNNILNQITAIYRPRLFIVEAGNSFGLFGDFASRLGLSVHRVKLAPGAGVS
LAPFADAWRLVDKPGEVQTLDADDLDEDRAETTRVADAEEQRDVLGELEITARLMITGGE
DKEETRMTRADRSLIRQCILDAAQRCVADKRMVLTRDVRDALRGRAHDSTLPEIRRARLA
EMADAMDMFCQGVDGEMFDRPGTPWPEADITVVDLATFAREGYNAQLSIAYISLINTVNN
IAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWYWLATQNLDDLPKAA
EPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMASARKETGKYSEGVILSKSMEVL
FRAVPPSLYLALAQTEPEEKAERFQLMQQYGIGELDAALKIAQRIDCARGIASLPLDGLT
P
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgatccgctcattctttaggacgcgccgggccgaaagggcaaccggtgccagtgaaccg
gctgacgaggcctggacccggcatgtgtcgttactggccgcgcatggcattaccgagccc
ggcagcgcgttggccgccggccgccgcaacccggccaccgaggcgcaggcccaggcgctc
tatgatgtggccccgtccttcgccgatctgctgccctgggtcgaatatcttcccgaatcg
atgagcatgctgctggaggacggcgattcggtcgcggccttcttcgagttggcccctgtc
ggcactgaagggcgcgaactggcctggctgtggcaggcgcgcgacgcgctggagaacgcg
ctgcaggattccttcgatgaactggaagagcatccctgggtggtccagctctatgctcag
gacgaggcgaattgggacggctatctgcgcacgctggcagactacgtccggccacgtgct
cagggcatcgccttcagcgagttctatctgcgcttcttcgcgcaccatctgcgcgcgatc
gccaagccaggcgggctgtttgaggacaccatggtcacacgcttgccgtggcgcggccag
gtccggcgcgtgcgcatggtagtctaccggcgcgcacccgcgacagcggtttcccgacgc
ggccagtcgcccgagcagtctctctgcacgatctgtgatcgactcgtgggcgggctcgcc
aatgcgggcgtgaaggcccgccgcatgcatgcggccgacatccatgactggctgctgcgc
tggttcaacccgcatccgacgctgctggggccgagtgctgaagattgcgagcgcttctac
gcgctgacccgctaccccgaggagggggaaacaggcgagatcgaactggctagcggcgac
tttgcccagcgcttgttcttcgggcagccgtgctcggacgtggccaacggcgtctggctc
ttcgacgggatgccgcatcgggtcattgtgatggaccgcctgcgcatgcctccggcgacg
ggacacataaccggtgagactcgcaagggaagcgatgcagtcaatgcgctattcgaccag
atgccggaagatacggtgatgtgtcttaccctggtcgctacgcctcaggacgtgctagag
gcgcacctgaaccacctgagcaagaaatcggtgggcgagacactagcttcggagcagact
cgccaggacgtgcagcaggcgcgcagcatgattggcagcgcgcacaagctctaccgcggc
gcgctggtcttctacctgcgggggcgcgacctgcagcagctcgacgcccgcggcctgcaa
ctggtcaacgtcatgctcaacgctggtctacagttggtgcgcgaggaagacgaggtggcg
ccgctcaacagctacctgcgctggttgccctgcgtcttcgacccggccctggacaagcgg
cagtggtacacccagctcatgttcgcgcagcacgccgcgaacttggcgccggtgtggggc
cgcagccagggcacggggcatccgggcatcacctttttcaaccgtggcggcgggccgatc
accttcgatccgcttaaccggctggacaggcagatgaacgcgcatctgtttcttttcggt
cccaccggctcgggcaagagcgccacgctcaacaacattctgaatcagatcacggcgatc
taccggccgcgcctgtttatcgtcgaggcgggcaatagcttcggtcttttcggcgacttt
gcctcgcgcctgggcctgtcggtccaccgtgtcaagctcgctcccggcgctggcgtgagc
ttggcccctttcgccgacgcctggcgcctggtagataagcctggtgaagtgcaaacgctg
gatgccgatgacctggatgaggaccgcgccgagacaacgcgggtcgcagacgctgaggag
cagcgcgatgtgctcggtgagctggagatcacggcgcggctgatgatcaccggcggcgaa
gacaaggaagagacgcggatgacgcgagcagaccgcagcctcattcgtcagtgcatcctc
gacgcggctcagcgttgtgtggccgataagcgaatggtactcacgcgcgatgtgcgcgac
gcactgcgcgggcgcgctcacgattcgacactgccggagatccgtcgcgcccgactggcg
gaaatggccgacgcaatggacatgttctgccagggcgtggatggcgaaatgttcgatcgg
cccggtacgccttggcccgaagccgacatcaccgtcgtagatctggcgaccttcgcgcgc
gagggctacaacgcccagctctccatcgcttacatcagcctcatcaacacggtgaacaac
atcgccgagcgcgaccagtttctcgggcggccgattatcaacgtgaccgatgaggggcac
attatcaccaagaacccgctgcttgcgccctacgtcgtcaagatcaccaagatgtggcgc
aagctcggcgcctggtactggcttgcgactcagaaccttgatgatttgcccaaggcggcc
gaaccaatgctcaacatgattgagtggtggatttgcctgtcgatgccgccggatgaggta
gagaaaatcgcacgcttccgcgagctgagcccggcacagaaggcgctgatggcgtcggca
cgcaaggagacgggcaagtatagtgagggcgtgatcctctccaaatcgatggaagtgttg
tttcgtgctgtcccacccagcctctacttggccctggctcagacggaaccggaggagaaa
gccgagcgcttccagttgatgcagcagtacggcattggcgaactggatgctgcattgaag
atcgctcagaggatcgactgcgcccgcggcatcgcatcgcttccgctcgatggattgacg
ccgtaa

DBGET integrated database retrieval system