KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7576
Entry
Dmel_CG7576       CDS       T00030                                 

Symbol
Rab3
Name
(RefSeq) Rab3, isoform A
  KO
K07883  Ras-related protein Rab-3C
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG7576 (Rab3)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dme04031]
    Dmel_CG7576 (Rab3)
Membrane trafficking [BR:dme04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    Dmel_CG7576 (Rab3)
GTP-binding proteins [BR:dme04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    Dmel_CG7576 (Rab3)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB FeoB_N GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase CPT
Other DBs
NCBI-GeneID: 36127
NCBI-ProteinID: NP_523687
FlyBase: FBgn0005586
UniProt: P25228 A0A4P7VAW6
Structure
PDB: 
4RKF

Position
2R
AA seq 220 aa
MASGGDPKWQKDAADQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKV
KTVFRHDKRVKLQIWDTAGQERYRTITTAYYRGAMGFILMYDVTNEDSFNSVQDWVTQIK
TYSWDNAQVILVGNKCDMEDQRVISFERGRQLADQLGVEFFETSAKENVNVKAVFERLVD
IICDKMSESLDADPTLVGGGQKGQRLTDQPQGTPNANCNC
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcgagtggcggagaccccaagtggcagaaggatgccgccgaccagaactttgactac
atgttcaagctgctcatcattggcaactccagcgtgggcaagaccagcttcctcttccgc
tacgccgacgatagcttcacatccgccttcgtctccacggtgggcattgactttaaggtg
aagaccgtatttcggcacgataagcgcgtgaaactccagatctgggacactgctggacag
gagcggtacagaactatcaccacagcctactaccgaggagcgatgggtttcatcctaatg
tacgatgtcactaatgaggacagttttaactcggttcaggattgggtgacacagatcaaa
acgtattcgtgggacaatgcccaggtgatcctggtgggcaacaagtgcgacatggaggac
cagcgggtaatcagcttcgaacgtggtcgccagttggccgatcaattgggtgttgagttc
ttcgagacctctgccaaggagaacgtcaacgtcaaggctgttttcgagcgtttggtggac
atcatctgcgataagatgtccgagagcctggacgcggatccgacgttagtaggcggtggc
cagaagggccagaggttgacggatcagccgcagggcacgcctaatgccaactgcaattgt
tag

DBGET integrated database retrieval system