KEGG   Drosophila simulans: Dsimw501_GD13415Help
Entry
Dsimw501_GD13415  CDS       T01065                                 

Gene name
Dsim_GD13415
Definition
(RefSeq) uncharacterized protein, isoform B
  KO
K12567  titin [EC:2.7.11.1]
Organism
dsi  Drosophila simulans
Brite
KEGG Orthology (KO) [BR:dsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dsi01001]
    Dsimw501_GD13415 (Dsim_GD13415)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsi04131]
    Dsimw501_GD13415 (Dsim_GD13415)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dsi04812]
    Dsimw501_GD13415 (Dsim_GD13415)
   04147 Exosome [BR:dsi04147]
    Dsimw501_GD13415 (Dsim_GD13415)
Enzymes [BR:dsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dsimw501_GD13415 (Dsim_GD13415)
Protein kinases [BR:dsi01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Dsimw501_GD13415 (Dsim_GD13415)
Membrane trafficking [BR:dsi04131]
 Others
  Actin-binding proteins
   Others
    Dsimw501_GD13415 (Dsim_GD13415)
Cytoskeleton proteins [BR:dsi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Dsimw501_GD13415 (Dsim_GD13415)
Exosome [BR:dsi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dsimw501_GD13415 (Dsim_GD13415)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set fn3 C1-set C2-set_2 BiPBP_C Ig_4 Izumo-Ig V-set_CD47 SH3_9 SH3_1 SH3_3
Motif
Other DBs
NCBI-GeneID: 6736448
NCBI-ProteinID: XP_016029961
FlyBase: FBgn0185128
UniProt: A0A0J9RNP1
Position
3L
AA seq 15524 aa AA seqDB search
MKIKLTITNGLGSLVADFSFNFNTLEVQQHHGGSIGGAYVPPSLTHVYAQGDISPPVFEQ
IFKNARFAQGGNALFEGRLRGNPKPFVTWTRKGAPLLESQKFRMSYNEATGDVSLLINQI
GPGDEGEYTCTARNQYGEAICSVYIQPEGAPMPALQPIQNLEKNIYSNGYSYTSIEEEFR
VDTFEYRLLREVSFREAITRRSGYEQDSQLSQELDRNQGPAQAPQISQKPRSSKLIEGSD
AVFTARVGSNPKPRLTWFHNGQRLVASQKYEISYSSGVATLRVKNATARDGGHYTLLAEN
LQGCVVSSAVLAVEPAAETAYEPKPVDVMAEQLEAGKALPPAFVKAFGDREITEGRMTRF
DCRVTGNPYPEVFWLINGRQVRDDASHKILVNESGSHSLMITNVTRLDAGAVQCLARNKA
GEVAIEAQLNVLEKEQVVAPQFVQRFSTMTVREGEPITMSANAIGTPQPRITWQKDGVQI
SSTADRFVGIDGGATCLEIPRVTANDAGWYQCTAQNIAGSTANRARLYVEVPREQPSYEQ
RRLNLPRPTKVIEPEPIPGPEIIYLRHVERAKPHLRPGEEDRVYPPPQFIIPLQNVQQTE
GGRVHMEARIEPVGDPTMVVEWYLNGRPLAASARATSVFKFGFIALDLLSIMGHDSGEYM
CRVTNASGVAESRAILSVVQRPSIEQSSQNPNSLQYINQLEDYSRYQRTESIDEQLNQAP
QFIRPLRDLGEFEEGKNVHFEAQVTPVNDPSMRVEWYKDGLPITASSRITAIFNFGYVSL
NILHLRAEDAGTYTVRAVNRIGEAISQSSIRVHSRSQVTADLGIPEQQRYIEKVEELEDY
RKSQQRRHVQEAAEAIAPPQFKTPIQNQLDLREHAHAHFEARLEPVGDSTMRVEWLKDGQ
PLEASSRITTYHNFGYVALTIKQLTIYDAGTYTCRAYNAMGQDTTVAQLTVISKNEIVSE
SQHPGGLQKIQHLEDSSRYGRREEEETYVTQAPRFLGPLKGTTKILEGQRAHFEARVEPQ
SDLGLVIEWYHNGRSITAANRIQTYYDFGYVALDISQVRAEDAGVYLVVARNKLGEAQQQ
ATMIVETRSSIDTSSMHRGLYEKTQNLENKPFVEPQYDIEEISKSKPVFVTPLSDPKPIH
DGKNIHLECRLEPMGDPTMRVEWFHNGRPVTVGSRFRTYYDFGFVALDIIKATAADSGEY
TVRATNHLGTAHTSACVRVIDHTDVVTETQNEQSLEQIQLLEDSRRRHHQEEDITIMQAP
QFTRGLHNIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALD
LLGCYAIDSGVYTCQARNQLGEAVTSCSVRIIAKNDLILETQNESGLQKIQYLEDSTRHR
RSEFVDEVVNIRPRFLTHPKSLTNTREGGHAHFECKIEPVTDPNLKVEWFKNGRPITVGH
RFRPIHDFGYVALDIVHLIAEDSGVYTCRAVNLIGSDETQVELQCRSGEQIVTVTQNEAG
LEQIHYLEDRSRYTRREEIDESTKQAPVFTTSLKNVEIKENQRAHFECRLIPVSDPSMRV
EWYHNNLPLKSGSRFTETNNFGFVALDIMSTLPEDAGTYTCRAYNAVGEAITSAVAVVHT
KKSIYLESQHETALPRLQHLEDGSKRQRISVQDEFVSQAPVFTMPVRDVRVAENQAVHFE
ARLIPVGDPKLKVEWLRNGQPIEASNRTTTMHDFGYVALNMKYVNPEDSGTYTCRAVNEL
GQAVTSASLIVQSKTSIQLETQHEAAMHKIHQLEDHSRYQRREEEEYTVTTAPVFVTKLI
GPSNLVEGQSAHYECRIEPYPDPNLKVEWFHNGKPLSTGHRFRTTYDFGFAALDILTVYA
EDSGEYTCRVTNNLGEAINSIVLNVTSRSSIIHETQHEEALTKIQHLEDSSRFQRKTDEE
QFHAERPQFGRPLRNAKVNEGAPVHLEATLIPVNDPTMKVEWYCNGRPIQTGHRFKTTYD
FGFVALDILYAHAEDTGTYMCKAKNAIGEAVTTCAVNVTANKTLDLDTLDAQRLEKIRQL
ETYAPPPKPVVEEKGQKPIFLTPLSNLEHLKEGEHAHLECRVEPINDPNLKIEWFCNGKQ
LPTGHRYRTTHDFGYVALDILYVYGEDTGTYICKATNQLGEAVNTCNVRVLNRRSMILDT
QHPDALEKIQKLESKVPNARTEVGDAPISPPHFTAELRGSTEIYEGQTAHFEAQVAPVHD
PNLRIEFYHNGKPLPSASRFHITFDFGYVSLDITHAVAEDAGEYSVRAVNALGQAVSSTN
LRVIPRGTIISDTQHPEGLEKIRKLESTAPHQRQEPETPGTRQRPVFTQPLQNIDRINEH
QTAHFEARLIPVGDPNLKVEWYRNEKIIEDSSRITKQHDFGFVSLDISHIRKEDEGVYMC
RAVNPLGEAVTTASMRVVSEASIQMDTQHPDSISRIHQLEKPLAPRPTEPERLFEKPIFT
QLLTGPSELWEGAHAHFEARVVPVGDPSLKFEWFINGVELQMGSRLRTTHDFGFVTLDIT
AVVPEDAGVYMCRAYNAAGEAVSSTAMKVKTKSNIDGQPLIPESWEAIRLKEAAMNRVPE
MFVDSTPQQAPVFTTHLQSYDKLHEGQHVLLEAQVEPRADPNLRIEWFKNGISLTTGSRI
RSTFDFGLVTLSINGLRADDSAIYTCKATNQVGEAVSTSSLKIEDRHWLQAESLHPDSLP
RIGELEAPKEGRPEAPEPTYETPVFITHLNNIECKESDNVRFECNVEPARDPTMSIEWFY
NGQPLQAAAKFKSIYDFGYCALDLTNSYAENSGVYTCKATNSKGSATTSGTLKCTGGKTM
FLDTQHPQGEAGLEAVQETEEELANRYTSKTAKPETQYPPPVWTKPLQAEFHLSEAQPIH
LEANVEPKEDPNLFIEWYFNGKMLNHGSRFKMTSEFGFVTMDMIEVYARDQGIYTCKAYN
KAGEAFTSTTIFCSSKENIIESTQHPKGAEGLEQIQDLEDSLRKDGSKPEQPDLGIPPRF
TTEFVNIADIGEGELAHFEANLIPVGDQSMVIEWFYNGKVLEASHRVRTIYAFGTVALEV
LGTKIEDTGTYTCRATNKHGTAEISCNLECVDKPRGQKPRFTSHIQPLEGLKDGQSAHFE
CTLIPVNDPDLKVEWYHNGKLMRHSNRIKTVSDFGYVVLDISYLQDHDSGEYVCRAWNKY
GEDFTRTTLNCGGRGGVFYDSLQPDSLQRIRELECPQGQQADTSAPLVAEPPKFITQIVD
VTKLVEGQSAHFEARLTPITDPDLVVEWYFNGKKLPHGHRFRTFHDFGIVILDILYCYEE
NSGVYEARARNKYGEDVTRASLKCASKSSLILDSQLPRGMEGGLEKIANLEYSMVRTREE
TTEETKGKAPVFTVPLENIENLREGENAHFEARITPADDPKLKVEWYWNGRPLKAGSRFR
TFCDFGFVILEISPVYPEDSGEYSCRAINEYGEAVTTATMKIQGKRSIIMESQLPKGMEG
TIDRIAELEGLGSRSTEFVPDDDTGKPPEFITSPFDMVIGENALAHFECRLQPINDPSMR
VDWFHNGKALWAGSRIKTINDFGFVILEIAGCYQRDSGLYTCKATNKHGEATVSCKLQVK
GRQGIVMEPQLPSNFRTGTESLQKLEETMHKREELVTEDEQPNPPKFTEEIKDNLDVPEG
GPIHFDCRVEPVGDPTMRIEWFYNGHVMATGSRVHQLNDFGFIALDVDYIYARDSGEYTC
RATNKWGTATTSAKVTCKGKHNIVYESQLPEGMTSEKLKELERGRIPEAPKVVEEVFGPP
KFTTQITSVTVDEAEAVRFECQVEPKTDPSLRVEWYRNGKPLPSGHRYRNIFDMGFVSLD
ILYVYGEDSGEYVCRAINNHGEDRTRATVSCKKLPTILLQNQVPRGMKRSDALTQMEATI
KKYTSEVHLTEDDLFDPDRKQPPRFVTQIKEQLTLTEMAVTKFECQLAPVGDPNMKVEWF
FNGKPLLHKNRFQPIYDFGYVAMNFGWVYPEDSGEYVCRATNLYGKDETRAIIKVSGKPG
IVYDSQLPAHMQSIDRIREMEASWQVVPDEVDPDAKPRTKPVFVSKLEPQTVEEGDPARF
CVRVTGHPRPRVMWLINGHTVVHGSRYKLTNDGMFHLDVPKTRQYDTGKVEVIARNSVGE
SIATTELKVVARSDDYRNVLKNSPRPWYDYELAAYQKERQENELEKVFDERKQVLSEQSS
HTLKGVEHLKPKQYKPPTPDWQQNVKAKKSEDYYNKLQTLETEQLLKETNLRRDTHQYAI
PGEKVVSSSQAKGMAQSYEENLQEKTSTTQVLAAPPKGTAQPSESSVHGREVHMNKQQQV
QKEIQGDLEITRKITATETTEVEHKGTIQERVVQGPVKPAKAPVFTKKIQPCRVFENEQA
KFEVEFEGEPNPTVKWYRESFPIQNSPDLQIHTFSGKSILIIRQVFVEDSAVFSCVAENR
GGTAKCSANLVVEERRRAGKGGIQPPSFVTTIQSTTVATGQLARFDAKVTGTRPLDVYWL
KNGMKIQPSIKFKMLEEDSVHTLLIIEPFAEDSGRYECVAVNAAGEARCDGDCIVQSPSK
PEKPTTPGSEKAPHIVEQLKSQSVEEGSKVIFRCRVDGKPTPTARWMRGENFVKPSRYFQ
MSRQGEYYQLVISEAFPEDEGTYKCVAENKLGSIQTSAQLKVRPIENLDAPPTITALKDV
SVTEGMPAQFKTTVTGKVKATSVQWFREGQLIPETPDFQMIFDGNSAVLLIGTTYEEDSG
IFTVRVTSSTGQVESSAKLTVKKRRISAFQLRTIDSAEDESSSSGREDSAPESPHAFQPG
QQPGQQFGQFLGVNGQGQHQGRSRQKKPKVRSKSLQPATKVIPWRKSSRPTRGRSLDKGV
FLPGFKPEPVKSWTEETISLKATPIEKKKPAPKLEAAKVVLKSIKTERDQGIMSLGATLE
QIIAGKTEKEAIPWITMREKLKAVESVQQQLNKFDLDEVYLQPLEGQIETEGQLPQQAQV
EQVQRTKEIQRLKSMESVEIMEMTDQIDKLITQQQNAKDLIPWKEMRQQLKSVQRVTKQI
DKFKIEEVELRHLQAQQAITEEYQTGTAEETVVMIDESSKGSISKVIRSDDLLQYEDQSN
IYKQKFVTTEDVNIMHVSEREKLEAQRLLREQQAVNWRQQQQRPQLQPLTSVEDTVISQT
TERQKLVQQQSFIEEAQRQQFVQVEDSQMMSLEQYEHQKIINQRTQQEAFSWRQPREPQK
FIQVEDSSLLHLQERHDTQEQQLLQQEPVMWDRGRKKPDQPQYVQPQEQRVKEEYVEKPK
TYEEMHDELVEPTPIEQPQPVPVMWERGKKKPQPQEKTFEEAHDELVEPTPVQQPEPVPV
MWERGKKKAAQQETVLSQEVVQTSQVVEQQIVEETKKTAVRRVIPPREPEQKVEQVTLKP
TPRPRPKEALKAEEIQLKPFRSTRPVPQPVEAEQKAYEEATDELPEEPLAPLQDQPQPVM
WERGKKKPQKPQEEVSEIPKTLEISVDALEEEVPKPTEPQPQPVLWARGQKKPQKPDEQK
PELPKSLEIAVDTIEEDLIKPVQPEPQPVLWERGKKKKPHPQDVIEEKLDAAPTKTYEEA
VDVLPDEPKVEEKPEPVLWQRGKKKIPKSEPTEEVHPDEVDAQIETVVKEDEVIVEEKRR
IKKTKKPKSTKEVTEELFEEQPEEEISPEEEVPQKEVIEEIEEIVEEKRRLKKTKKPKLT
QQVTEEEKPDEVVIEESEEVVQEQEEIVEEKKKVKKVKKPKTVAEKQLEEDEIPAEETVE
EEETAEDQQLVVEESKKVKKVKKPTRKVEKTDVEELPAEEVPAEEVIVEEVPEEVAPEEE
PIEEQEEIVDQDNIQEQKRKVKKAKKPKKTIEKNEIEREEDQPEEEVPQEEIIEEQEEIT
ERQRRLKTIKKPKKIVTEQTVEQAEQTEKPEESQAEEVKETVTEEPKKPKPAPEEAKVEQ
IEKISLKPAPRKQRLLPEKEQVEEVLLKPLKKIAAVSEAEQPETPETEFEVKEFAITTTE
DIVDVTKKRVKKKKPKTKVATEESTEEPAEETEEFEEDEAQPEEVQPVEEIPEQPQVEEV
ADERKTAPKPKPRKEEIIEKVEEVALKRVTRPKKELPQEATIEEVRLKPTQRTSIKPEEV
KLEEVDLQHVEKKEDEIVQEEKRKTRKVKKPKHEDLPEIPDAEPTQLEEAEHIELEKQPK
PEEAQPQVPWKRGEKKQPVEEVLEEKKWPSGKRRPLPEQQPEEVQLKPIPSKPIEEPQKP
EKAIPGPQLVPEEKPESEEEELELEPLKLPEDKQPKEPKAKKEKKKKPKLKKATPSVDEV
SEEVAEPFDEPIAEEDEVEEMPVDDDKVVAVSEDVLPEEEVVPTEETPEAKQKAHKKRTK
RLKEASVEDQPQLLEAAIAEIEKVDEISQEISQKTITLLKKTEDTRPQFITTEQLIELDV
EDVRRDLEMKVTSNIIKKEKRRVVLDDSQPLPELELITQKRIQEGIDKVADEELIEDQQL
TQNQQETTTSEVIGQERKLVKKKKKEIKPPRITEKLRPRQCVPEEPTVLECKVEGVPFPE
IKWYFNDILLFASEKYEITVIEQVAKLKIAKVTPSDVGVYTCEAKNEAGVATSRTNIILE
KEQGVPPQFTKPLKIEFTEEKQPERLKVTVTCQVTGKPNPQVKWYRGIEEVIPSETVQMF
YDEKTGDVALEVINPTPNEAVVYSVQAQNQFGRAIGNANILSRVDEVPREILKAPTVTPL
SAVVVPTGGTLFFQAKYDGLPRPEVKWMRNGREIIENEETIIETTETTTTIKVVNMTRKR
TGKYEVWAKNKVGEAKSSGSVVVSDQKPDEQIKPPRFIQPLEPKYFGEHEVAIIEAIVES
EPLSSFQWYVHNEPIKSSNEVRIVSQANKSTLLIEDFQSKFVGPFTCRAENVGGSVTSTA
TVNLIESLPQEEAEEFESPRFVEELVQPVEVMDGEALLLTCQVTGKPTPKVEWYHNAEKI
TENKETTISQDLQGVCQLQITEVFPENEGQYECVATNKIGKSVSKTNVKIQAFEYIPDSE
ITGLTGSEEDLLDRTLSIDEQAPKIIKKLPEKIEPKEGEQAKLEVKVVGKPKPKVKWLRD
DEQIFASEEYQIENFEDGTSVLVINHVYPDDLGTISFEAYNPLGVAVTTALFAVEGIVGS
KDYRKPEWVSQMEEMQVALKETATTKVEKLFKKQEQEHVQSVEQEVEIQVQTKQIAQMNT
KIKKHKKHKQQEQDVSETTIQYEQKETLAHETSAGLPQAETLEQIEESLPTYETLPIQNL
SKDTLETVAVAVTAELSTPKPIAARVQEEILPEKVLAINEEVLPLDEFALRKESPRPEEN
KLTENMEVRLKHSLNVSQAKTAESSKELPSKIPKSVKAQRKMKESRSLLVEAPNAEEAIE
DLKPLKAVSQKVHGDILFSHEITEEQHHALETIEKLKPTSAIEDTVQQKLLNQEELIIAE
VLPSETLGRDVTDFRPPGETILPRLTPNMSLYITECQPEDSIGEMQQAAKERMETPALSV
TESKAVGGQELEVLESVDHIPLITQPTKGLADYTIKAEEVPVQVHEITTFDSLERETVSK
TQTAKSNALELFELAEGLVSITADSHSPIAEDLPIFEKDVKEATIDMQMQHHVTTFETVS
NENAVKDVTAADTPKMAEGTLGQSSALTIGETQQMNLVETAVELIEPNVESTKPAKGALT
EAYGTAESNEETLLESLGLVPDDNRKTEQGKVNISEGEYVAKVQTTTVTDTEEEFVSVAP
KLVDAKFDFVEQSALQIKENTTVEKEEILSPNIEQAPQLAISNMFPAELKVTSIYEVQPG
ATSSNIITEETKSVSAKQVFETMSIGVTSKPAMLESTSHIDAFQHPEFRTGDTVLDENQQ
PLEVTNVQITESSTDIIDVFPNQKLTKAEAVTDAFKHAEGLVVLSMESTIDKTEDTKPTA
VIADISMHEQFGTDVREQEPLESTQTRTEDLKPQTQTPESQFGLLQPLETSSCVTLEGES
ILSVKEPHSKQSAAIGTSSALQVANIMRPQHMESLERLDEQKVPNYQANVNIGEITLPNV
EKIASFDVLSDLDTPDYNKSSISRVQLIEGTTSLKTTTAVVSESTEELKDLNITQPVHIR
PKPYESDQKISISEQTNVLEHVSSLSPVLPTLETIQSSINSLHEINVRETDILEKEESLK
DVDQISGRLAKIVLDCTSGIAQVRQEETLEHEEDLTSPSVLPEKAIPASSELLRLPLTEY
VQEQQGTGDMVDFKVSNKCASPKIDHLYETKSSEMIVYDSSTNSVDSEFPAGIVPQKSLV
PYRHTMVTENVAFHASENLEILSAGQQIATNVQDSLSQSIIAQDQTTFESEQNLGLETTP
TQKSKLLKDDRNLYAKLVDEATVYEAMGQEQKVNKYNIQQAEITHDLPQVYATDLQQTFE
AEKEIKSPEQSYVAATIDIIPSRLGLAMTTKTHPVEGIDVLLSSPPKPTLVQTNYEETKH
HVHVRETQAIEESGELIDGRLLPVSAVESIDITFKVTSDSHQPPVFDKELSIPTVSPLEA
RAKPSLNLLQGATTFDVIPLESSVLIKDTHVAGQKAQQEYVAQVESNKVHVQMDNLVMDK
EDIFENDKMENFCKPITEGTQRETVVIEVVPIDNVGGIHLAPQPSTFLATFTPTDILNQS
HVIDTQVPLEMESEAQAAYDNIAQARIKSAEAHVHTNVSEVNAYEQTKAIQNQSKQGLFA
NVSEDSDSSKAYLTTIQSTFLKEDILPKPNILQDTAQAANVELQSLVTEEVVSVSSIQET
YELQIPLTETANLTQQTPQNSVNVCQQLAYEQTPDIAFEPHALTRATTSSVTTFLKPAEN
ATVNIYENIEGHGDFKPETVNLRSNSNLDSELVVSVVQEVTSVPSLGSLATVKPQELKAV
PVTKSSKNFAYSEEEESPYVQITVEEAKLVNTRAGVEENKISVTTEQPNTCIAASIQMST
IREEKLENALQTSQFAPESILKISPQISPNAHFETRTHEEAYSTTTESLVTTHALRDDIN
SSRKKVMQDVQKYKHFATKSLDKTVKVDTVDKPKADNTETEHPVYITTFKSVQNEDGETT
IQTENKRISQEEGIVVEEVLSDTELIPEDKTQLHLEITEVSEPTDQYYKEYTITEPEEAS
ADALQKPTKDKTPKQKKTLETPIEEVDETVIVHEGTGEQTDKIAMKRKPKKVQGNVQVEA
VDEKPIEKKEKAKKKKVVKTKRDEMDDYIQFLIHQEIPKTVLQPYQRTEMELPQRARRDS
SFKQPLKLTPMKIEKVEFKKPKMVEISSVVEFPQMLKLKAPKQRPQEEKKKKTEASFKNK
KLKSWIRFVPYAPYCFPYVVTELETNREVGELSRNVEEAEEVLKLRPRKFRHPKPEKADL
EEADLGTYESDHSEKSNKELLHPKYKRAKKQKSETPDESRKLKIGKGKVPQNEEASEEVN
LKPVKLDIAEIEDGEKPVRQLEEEVVKKKKTKKSSKPQEGLQFEPIEFEEMERTSDIREE
SDTSVSVDTSTQEKPIYKKKKKVTPSPQKNQYEILPGQPREFEETPEDDLKLRKRQGERP
DDDMADTKLKPFYKFEVLDLEPEGAQAETVPLSETIAKEPKKKRKIKVKTEQEDNTIEIV
PLSPVDNDEQIFEITVTSSEILRDDEKATTIAKKKVKRMNKQELDDFVTELQEEPNQEVY
ETTMSDFYEVKLTELPSEMDNDKPRKRILRHEKGDEVQVVEIVEGVVAPGVEPFYEITVI
SSENTEGDSEEITTDKIKKKSRKMKKNELDAYIQQLINAEIPVTELEKYEKIDVDGKAKK
PKKLKAKPEKPIIDEGETLQVRVTEHEPTKKLKTKKPVEKKSVIEKEMHEQEAVPEYDEF
LINKTESESPQEKIIEETEKDIVPVVDKVLADLSDCLPFVVVEEDFKNMPLANDVIALED
EKIIRKRKVRAKKDSKQYEIEIIETEKPGDMPDEARVIVITTEVSGDTIDGPAPSTTEAP
KKSVRKVKKEKLKEFIVNVVEEAPLDHFSDIYEDVPRPPVRESSEKEDIGSFTTTVVEDE
IVEPVLSEKIKSVDDVLVPKDKKKKTDNQKKIKISEFEPTPTSEDSTIEEYTSKLSEHDE
NLQADEYLVDVKDSLPKSKKKSTKKQKEESLPGPISLYTIRIEESTPEPITEKIYEDGKE
IVRVTNKRKIKKKAGPREYLIEVTETYEDNNPEADVVIRTIETTPSIDSKPQEDHKIQIV
QEKKPKTESLDNYIQKLIDQEIPQLDHKEFEATVLETSPESKKARKIKKHHKKTTEVIDG
IPITVIEVTIQESEPDEDDFKPDAFTLEEIDHENAEDAPKDLKIKVTEEKPKSKKEKSFK
FKTAEEDKPQPVIEEISEDVQVVQIIEEDGTPKQVEIKKKKVSRKHGPKKQVFEITETKA
IDEPLAEVTVVEITEEKPEEEVLAAQENKSIKKQKKLKPEDVNTYVIKVLEELTEPTQFE
TLPEDADDKPQPVIEDISEDVQVVQILEEDGTPKQVEIKKKKVSRKHGPKEQIFEIIETR
PSDEPLAEVTIVELTEEGLKKDIVIPQETKTVKKPKKLKPEDIQSYVINVLEEFNEPQWP
ENTEKPIIEDLAESIEIVPVTEEDGITKEIEVKKKKVSRKQGTKKQVFEIIETKTSDEPL
AEVTILELSGDKSQEDIILPKEKKPIKKTIKLKPEDVESYVVNVLEEFCEPQSFESPEPT
DGEALETRTKTKTPKKPIVKAPENVILIEEMAPETVIENIVNEMGEEVKQVKTTKKLKKK
EGPKEYIIEIKETYEENKPEGDIEITTTEMVPEGSPDASDDQPVIVLQKVKKKKPVKDDL
DKYIQQLIEQEITKTPLEEYEPTEMESKKKPKKKVKSHHKKTIEVIDGLPVTIHEFNVED
IVPEPEDMEKPKTLLDEIKEIPQLPDDSSEYLVNISDEFGEADKPIKQPTEDQPIKKEKP
LKKKKVVETPVPLEAYDHTVEVVAEPTLEGTLKEVTVKKRKVSRRKGSKDHIFEITETTS
EDHPTAEVTVVELSSDEILDSEEKPKYERKIVKKPKQLKKDDVEEYIINIIEEFIQPIPV
GLVEGDVEKVPKEKTKKPKKSPTTHIATEQEDNNSNYDALVEEDLDQPIECALEKPSNPL
EYTISVEEESVGEEQKQPKPKKISKPKSIKQPSVDKSPDYLVRVLSSESIIDEPIPEDNA
VTEAAEDKPSEEPIFQVEELETEAVEKEVTDDKGETTKQSVTKRKIKKQVGPKEEIIEIV
EINTGDTPEYEVIVTTEGVQEKTKEAPEEKKAKTVRKAKKIPKDDLQDYIQKLIEQDIPK
TELEKYEKIDLDEPIKMKRKPIKKVKPSKEQPKEETEEPMEDKPAVKISECSEVGSDEPK
LTVAVKEFIPEKPEEKPFEIVVLEETVASYQEPDEEGKVKEKVVRTKKIKQNRGAVEVVH
DIVEEIDTDTNESLITVTTTVPTETPDQDQPSVKQKRTKKIKKVEVEDFVKRVIEEEAPQ
TEEPVDLVVIEDVVPKPSSEKRKKKPIKDKHTSVEEETPHEDEVLLIESFPEDSPVSDNL
ITVVESVPIEEEPEKIVDQIEDTKKPEKKKKPISSAKILAEKVLEDTVEKPLEALHKDSE
LENPDVQEFCVSIKEEEQKHTHPEKKKSPKITAEKPNQPSTEQYEISVTQHELKPEEEKP
FTVQVIQSETNVEETKDDTGKVHKQVTTKRMLRRPAGEGEIEIIEVVRDDQPEAEITIVE
YEPEPLNQDEKPKEPKKKTKKVKKDDIHDYIQKLIDLETPKTELEKYEKIEFEPIVKDKP
LDSPIDVLDESPKEVPKKDKISRPTKVPNEETPVEDQYAKVKVVEEEAPEQPEKPVQILE
VKPVEVDVKEVITEDGKPVHEKTTKRVLKKVGPEEQTTFKITTIESEDNDSVTVIVDEEP
EIASPQSIKEHLEQPEEKLAPKPKKTVRKVKKDDLHEYVKKLIEEEIPKVDLEKYEKVEM
PEKPDKLAVSDSIPEEPKPEKTQPISVLPDTPKLKKTKTPKTPKTEDTDQQVPDEPTETT
VDTTDIPELTPTQTAQPEDTATAQITPSAQEDKSTQDDTKDTIQKTVKHKKTKPDTQKSV
ETSELPEVHKDYQISIIHEELVEEDQPEKILEVRVIDEVAEAEESQPIVKEVVEEEPQPA
TEETVEDVTKPKSKKKKVVKKKTDDHDELIKKMLEQEIEKTELEKYEKIEFDVPKKLKPE
FAALEPIKIERKEQKPTKVTILDATDVPKSVKLKPSKRKEKPAEELTVQLPKFRLKARMV
MVEYPPAPLIPKTTDIGAIKDNGELSRNIEEAEEVLKFKPHKTKKIKKIKDDLEKVELEK
YEKYISSEEEPEEKTPYKKPEKAPKPEEKPEDVKLKLGKGKKKPKEEEAPENVTLKNIPQ
KPQEVEEEVELKQKPKEVDIVEEQTKEPKVGEFVVPPFEPSEFDRPEYVPDELEQIEHPE
MPEKVKKPSKTKYKPKDKSKPEPETIVSEIVAGVPKEEEAIPEQDVKFRKPERDAPEETD
SEIKLRPIPQASKDEKPDEQALVKPKAEEPIPQEIEDKAIDDEKKTKKSKPKKVQPKEQE
IAKEEPQEFEVSVKEEEALVDKPVEIEKPKDVKVKEKKPKEAPVSEVVVLEEEPKPEEVP
EEIPVEYKITTTVLEPEDAPKEHQVKVIDFDERQETTEEVIEEKVVTRKKKPKPQQPEEF
EVTLKEPKEEQLHPDVVSAEISLPIEEPERKPEEYEVELKITQTTPEEPKDVEIAVKEKV
KTKPVKEVKEDKIVVVEAEEEKQPVEETIVEVEEQEEKKKSKKPKSYEFKISETQSIEEK
PIEVAEEAPEEKPKVVEKKVAEKFDSYEFTLKETDEEKVITVDDQPEDEAPVEVVFKKKP
KEPEAVETEFVMTEPKIVEETTVETAIKQKKTKKPKKNEEEAQLAIKVVESEAPVAEEVF
HEAPESVIVEEEVIAEEEPKEFTIRVSETERKPDEPSVEQFKVKKRKPSVTFADEPATEI
VIKESKPAEVVTEDAHIKTKKPKKKVTEVEAEELKIKITEEVPQEIPIVEEVSEEEVITE
TKKTAPVVEEKTYKIGIKETEPEKPAEAIVEEEPVVTEPIEEAPKPEVFEEHKVRVIEET
PRELVEEVIEEEVKVIRRKKPKPEIKEEPEAEVTVSTPKPVEEVEATASIAVIPEQPTEE
DAADLKITIIEEETPPQELVQEIEEIEIVEEPKAPEEQPTDFTFVTKDSEKKPTVEELPE
EQVTIQKKKKKAPEPEVVEEPEAEFVVKPKTPVQEVTEEAKITKKTKKPVKEEEAAAELK
VTITEEIPTEPEVQEIIEEIEEVAEEKPAEYLVEVKESQPEAVEEKEVSLPKKKLKAPIV
EEPEAEVTLKPKTKTEEVQEEAKIVKKKPKKTVEVAVADELTVKVEEEVVPEPIVEEEVV
EEIQIKKKPKEPEPEDIVDTAVVKLKKSEPVDADDVVAEVTLKPKAKKEVTEEEFSVDVK
LSKEKKITEETSDQTVQLKKKKKPQKPVEEAADELKLQQTVVEERPVEIEEEEIVEEAIV
VRRKPKKPFEPTVEDLEETEFSLSFKKPHTFNEGVEEAATVLKKRPVKPTTLDEAAAELS
IKRQEEEYEEGEDIEEFVVSQQRKPKPLQITEEDEQAYTVKKLKRRKQVDIPEYADVENV
TFRARSTKTKEDVDQEFNIALDSYAEEEISMSGKVKLKKPIKKTFSEAADEARIKIIQDF
DDGEEPIIEEIRDDEDTIDEVEEPEEYFVEELPPDEVDFKLKPKKQPKPAYSIQDEEEEQ
FLIGIRHPKRDSVTYDEDSLTFKKKRKVVQQLFNEDGASLNITREMNVEESENLNVMYSI
CNYIADNNEAINLVEGEKVTVVGRHSSEWWYVKKSTTEEEGWVPAQYLMEPEEYAQYVQN
KLHEKIDKLPVFERPGPEDKPIAPRFIEKLQPIHTPDGYTVQFECKVEGNPRPQIAWFRE
TAIIKPSQDFQMFYDDDNVATLIIREVFPEDAGQFTVVAKNAAGFTSSTTELIVESPLSD
HGSDATALSRRSMSRESSLADILEGIPPTFSKKPKAQYVDENTNVILECRLVAVPEPDIV
WTFNGEDIDEEEIKNVRIVTESDMHMYCSVVHISKVKKSQEGTYEVIATNREGEARLPIT
LKVRTTDKEAPQILEPLRNMVIREGESVVLSTQIVGNPPPKVTWYKDGKPVKNAKSDKDL
HTLTLITPQKSEKGEYTVKAVNPLGSVETTANLTIEEPAGGNAEPPLFVERFEEQNVPQK
GEIRLPAKVSGNPVPEVQWLFNNTPLFPSERIQQVYDGENIELIIKDANPETDSGDYKCI
ASNPIGKTSHGARVIVEVDEVTFTKKLKKTITIEEVQSLTLECETSHVVTTKWFFNGKEL
SGMDHRVVVEDGKTHKLVIRNTNLRDSGTYTCKVKKQETQSTVEVLQRKPDFIKVLEDYE
VTEKDTAILDVELTTEATEVTWYKDGEKITQENKNVEFIKDGKARRLVIRDATIHDEGQY
TCKIEGQECSCELVVIELPPEIVEPLNDVAVTKGENAVFEVELSKGDALVKWFKNGKEIV
FNERIQLAIDGKKQSLRIVKAKPEDVGEYSVQVGEHTSKAKLTVEEPLVDFVIRLPDITL
ATKTTDAEFTVQLSQPDVEVTWCKKGKPIKPNQKHEVFVEGTVRRLVIHDASDEDAGEIS
CVAENVTSSTKLCVEELKLPPVITSDKDQTIKVKENDDVTFSVKYTGVPTPEACWTTRKV
VVPKSKRTIPTIDEQSATLTIKKVVDDDEGEYTVKLVNPVGEAEASLHLVIMRKPTAPGT
PQPLEIMHDSITLYWKAPEDDGKSEIIEYILEYHDVKEEKWTEIRKIKDTTYTISKLKID
TEYVFRSIAVNEVGPSPPSPLSPPIRLVPKVETKAPSVQEPLQDVVSELDKEVTLSCVFG
GIPEPKVTWKKNGQVFESSSIRYENRVAKYTIEKTTIETEATYTCVATNEKGSAETSCRL
KLQQKPVLEVEDKYLTQKLRTGSTLTIPATVRGYPQPTVTWHKETIEQKTTKSVTIETTE
TTSTYTVKKVTREQSGKYKVTATNESGTTYVECTVQVIDKPSRPQSLEIKDIKKDSIILE
WTPPVDDGGLDIEKYTLEKCDVQNNVWMKVSDFNKDIKSYAVQKLSMNAQYMFRVVAANP
IGESEPTESDPVTITKKFEKPSPPRGPTTVSGMNDTSFNLAWEPSETDGGSKIIEYIVEI
REETETTYRSVGVTLGTVTNIHVKKVVRNKGYFFRIYARNEVGTSEAFETTEKIVMGRKI
TPPSPPQNLRAPDVTSRSVTLDWEVPARNGGSEITGYCVEKRSSTSTNWTKVITLDAHQL
HYTIDNLKEKCEYWFRVSAENEVGLGAPAVTESISLKTHASEFILVVRNCGSHTEFGFLK
AVPSPPTGPLEARVLAANAHIFEWGLPESDGGAPLLGYHIAIRDMKKTMWIEVGRVPAGV
QKFQIRDLQENHEYMIRIFAKNEIGLSEPLESEEPYKAMTAGHESLPDEPRTEMSSCNTS
SWLRDHHMDADIHSYARGRLLQRDEYFFRLWAELPKSKKKKSSK
NT seq 46575 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaagctgacaattacgaatgggttaggttctttagtcgccgacttttctttt
aattttaatacacttgaagtgcaacaacatcatggtggcagcatcggaggcgcctacgtg
cccccttcgctgacacacgtgtacgcccagggcgacatctcgccgcccgtcttcgagcag
atcttcaagaacgctcgcttcgcccagggcggcaatgccctgttcgagggacgcctgcgt
ggcaacccgaagccattcgtaacctggacccggaaaggcgcaccccttctcgagtcgcag
aagttccggatgagctacaacgaggccaccggcgatgtgtccctgctgatcaatcagatc
ggacccggggacgagggcgagtacacgtgcactgcccgcaatcagtatggcgaggccatc
tgcagcgtctacatccagccggagggagcaccgatgcccgccctgcagcccatccagaat
ctggagaagaacatctactcgaacggttactcgtacacctccattgaggaggagttccgt
gtggacacgttcgagtacaggctgttacgcgaggtttccttccgtgaggccatcacccgt
cgatctggctacgagcaggactcccagctctcccaggagctggaccgcaaccagggtcct
gcgcaggcgccgcaaatctcgcagaagccgcgtagctccaagctgatcgagggatccgat
gccgtgttcaccgcacgcgtaggatccaaccccaagccccggctcacctggttccataat
ggccagcgattggtggcctcgcagaagtacgagatctcctattccagtggagtggctaca
cttcgcgtgaagaacgccacggctcgagatggcggtcattacaccctgcttgccgagaat
ctgcagggctgcgtggtttcatccgccgtgttggccgtggaacccgctgcggaaaccgct
tacgaaccgaagcccgtggacgtaatggccgagcaattggaggccggcaaagcattgccg
ccagcctttgtgaaggctttcggagatcgcgagattactgagggtcgcatgaccaggttt
gattgccgcgttactggcaatccttacccagaggtcttttggcttatcaacggccggcaa
gtgcgcgacgatgcctcgcacaagattctagtcaacgaatcgggcagccactccctgatg
atcaccaatgtgacgcgtttggatgccggagctgtccaatgtctggcccgcaataaggcc
ggtgaagtggccatcgaggcacagttgaacgtgctggaaaaggaacaagttgtcgcacca
caatttgtccaacgtttcagcaccatgactgtgcgcgaaggcgagccgatcaccatgagt
gccaatgccataggaactccgcagccacgtatcacctggcagaaggacggcgtccagatc
tcgtccaccgccgaccgctttgtgggcatcgacggaggagccacctgcctggagattcca
cgcgtcactgccaacgacgctggatggtaccagtgcaccgcccagaacatcgctggatcc
acggccaatagggccaggctgtatgtcgaggttcccagggaacaaccaagttacgagcag
cgtcgtctcaatctcccgagaccaacgaaagtcatcgagccagaacccattcctggccct
gaaattatctaccttcgccatgtggagcgcgccaagccccatctgcgccctggtgaggag
gatcgcgtctatccgccgcctcagttcatcatcccgctgcagaatgtgcagcagaccgaa
ggtggccgtgttcacatggaggcccgtattgaaccagttggcgatcccaccatggtcgtc
gagtggtacctcaatggccgtccgctggcagccagtgcccgcgccacatccgttttcaag
ttcggctttatcgctctggatcttctgagcattatgggtcacgactccggcgaatacatg
tgccgcgtgaccaacgccagcggggtggctgaatcccgggctattctgtccgtggtgcag
cgcccctccattgaacaatcttcgcagaaccccaacagtctgcaatacatcaaccagttg
gaggactactcgcgctaccagcgcacagagagcatcgatgagcagctcaaccaggcgccc
cagttcatccgcccactccgcgatctcggcgaattcgaggagggcaagaacgtccacttt
gaggctcaggttacacctgtgaatgatccatccatgagagtggaatggtacaaggacgga
ctacccatcacggctagctcccgcatcactgccatcttcaacttcggctatgtctccctg
aacatcttgcacctgagagccgaagatgctggcacttacactgtgcgtgcagtgaaccgc
attggagaagccatcagtcagtcctcaattcgtgtccactctcgttcccaagttactgct
gatctgggtatacccgaacagcagcgatacatcgaaaaggtggaggaactggaggattac
cgaaagtcccagcagcgtcgtcatgtccaagaggctgccgaggctattgccccgccccaa
ttcaagacaccgatccagaaccagttggatctgcgcgagcacgcgcatgcgcacttcgag
gcaagacttgaacccgttggagattcaaccatgcgtgtcgagtggctgaaggatggacag
cctctggaagccagttccaggatcaccacctaccataactttggctacgtggcgctgacc
atcaagcagctgaccatctatgacgccggcacctacacctgccgcgcctacaatgcgatg
ggtcaggataccaccgtggctcagcttacggtcatctccaagaacgaaatcgtttcggag
tcacagcacccaggtggtctgcagaagatccagcatctcgaggactcgtcgcgctacgga
cgtcgcgaggaggaggagacctacgtcacccaggctccccgtttcctcggccccctgaag
ggaacaaccaaaatcctcgagggccagcgcgctcactttgaggcccgtgttgagccccag
agcgatttgggtctggtgatcgagtggtaccacaacggtcgctccatcacagccgctaat
cgcatccagacatactacgatttcggttatgtcgccctggacatttcccaggtgcgcgct
gaagatgctggcgtctacctcgtggtggctaggaacaagctaggtgaagctcagcagcaa
gcaacgatgatagtggaaactcgttccagtatcgacacatctagcatgcaccgcggcctg
tacgagaagactcaaaacttggaaaacaagccgttcgtggagcctcagtatgacatcgaa
gagatctcgaagtccaagccggtgtttgtgacaccactaagtgatccaaagcctatccac
gatggcaagaacatccatctggagtgccgccttgaaccgatgggcgatcccaccatgcgc
gtcgagtggttccacaacggtcgccccgttactgtgggttcccgattccgcacttactat
gactttggtttcgtagctttggatattatcaaggccacggccgccgattctggcgaatac
actgtgagggccaccaaccatttgggtactgcccacacttcagcctgcgtgcgtgtgatc
gaccacacggacgttgtgactgagactcagaacgaacaatcgctggagcagatccaattg
ctcgaggactctaggcgccgccatcaccaggaggaggatatcaccatcatgcaagcgccc
cagtttaccagaggcctgcacaacattgaaactattgagggtaccaacgtgcacttggag
tgccgcctgcagcccgtgggagatcctagtatgcgcatcgagtggttcgtaaatggaaag
cctgttaagacaggacatcgattccgtccagcgtacgaattcgattatgtggctttggac
ctgcttggctgctacgccatcgactctggtgtgtacacctgccaggccaggaaccaattg
ggcgaagccgtaacctcctgttccgtgcgaattatcgctaagaatgatttaattttggag
acccaaaatgagtcgggtcttcagaagatccaatacttggaggactcgacccgccatcgc
cgcagcgagttcgtcgacgaggttgtgaatattcgtccacgattcctcactcatcccaaa
agcttgaccaacacccgagagggtggtcacgctcacttcgagtgcaagatcgagccggtg
actgacccgaacctcaaggtggagtggtttaagaacggacgtcccatcactgtgggtcat
cgcttccgtcccattcatgacttcggttatgtggccttggacattgtccatttgattgcg
gaggactcgggtgtctacacttgcagggccgttaacctgattggctctgacgaaacccaa
gtcgagctgcagtgccgcagtggtgagcagattgttactgtcacccagaacgaggccggt
cttgaacagatccattacctagaggatcgctcgcgctacacccgacgcgaggaaatcgat
gaaagcaccaagcaggctccggtgttcactacatcgctgaaaaatgttgagatcaaggag
aaccagagggcccactttgaatgccgtctgattcctgtttctgatccgtcaatgcgcgtg
gaatggtaccataacaatcttccacttaaatctggttctcgattcactgagaccaataac
ttcggctttgtggccttggatattatgtccactctgcccgaagatgccggcacttataca
tgccgcgcctataacgctgtgggtgaggccattacctctgctgtagctgttgtgcacact
aagaagtccatctacctggagtcccagcacgaaacagctctgccacgtctgcagcatttg
gaggatggctccaagcgccagcgcatcagcgttcaggacgaattcgtctcccaggcacct
gtcttcaccatgccggtaagggatgtgcgtgtggctgagaaccaggcggtgcactttgag
gctcgcttgattccagtgggagatccgaaattaaaggttgagtggttgcgcaacggtcaa
cctattgaagcatccaaccgcactaccaccatgcatgactttggttatgtggctctcaac
atgaagtatgtgaatcccgaagactctggaacctacacctgtcgggcggtcaacgagctg
ggtcaggcggttacctccgcttcgctcattgtgcaatctaagacatccattcaactggag
acccagcacgaagccgccatgcacaagatccaccagctggaggatcacagcaggtaccaa
cgcagggaggaggaggagtacacggtgaccaccgccccggtatttgttaccaagcttatt
ggacccagcaacctagttgagggtcaaagtgcccactacgagtgccgcattgaaccctac
ccggatcccaacctaaaggtggagtggttccacaatggaaagccactgagcactggtcat
cgtttccgcaccacgtacgatttcggatttgccgccttagatattctcactgtctatgct
gaggacagcggcgagtacacttgccgagtcaccaacaacctgggtgaagccatcaactcg
attgtgctcaacgtcacctcacgctcatccatcattcacgagactcagcacgaggaggct
ctgactaagatccagcatctggaagatagttcccgattccagaggaaaaccgacgaggag
cagttccatgccgaacgtcctcagttcggccgccctctgcgtaatgccaaggtcaacgag
ggagctcccgtccacctggaggccacattaattcctgtgaatgatcccaccatgaaggtg
gagtggtactgcaacggtaggcccatacagactggtcaccgcttcaagaccacctacgat
tttggcttcgtggcgttagatattctgtatgcccatgccgaagacaccggcacctacatg
tgcaaggccaagaacgctattggagaagctgtcacgacttgtgctgtaaacgtaacagca
aacaagacactcgatcttgacaccttggatgctcagcgtttggagaagatccgccaactg
gaaacatatgcgcctcctcctaagcccgtcgtagaggagaagggccagaaacccattttc
ctcacaccgctaagcaacctcgaacacttgaaggagggcgagcacgcccacttggagtgc
cgagtggaaccgatcaacgaccccaacctaaagattgagtggttctgcaatggcaagcag
ctgcctaccggtcaccgttaccgcactacccacgactttggttacgtcgcattggacatt
ctctacgtctatggcgaggacaccggcacctacatttgcaaggccaccaatcagctgggt
gaggctgtaaacacctgcaatgtgcgcgtgttgaaccgccgcagcatgatcctggatacc
cagcaccccgatgccctggaaaagattcaaaagctggagtcgaaggtgccgaatgcccgt
accgaggttggagacgctccgatcagtccacctcatttcaccgccgaacttcgcggttcc
actgagatctacgagggtcagaccgctcactttgaagcccaggtcgctccagtccacgat
cctaacttgcgcattgagttctatcacaatggcaaacctttgccgtccgcttctcgcttc
cacatcaccttcgattttggatacgtgtctttggatattactcatgctgtggccgaggac
gccggagaatattccgtgcgtgctgttaacgctttgggtcaggctgtgtcctccacgaat
ttgcgcgtaattccgcgtggcaccatcatttcggacacccagcatcccgagggactggag
aagatccgcaagctggaatcgactgcgccacatcagcgccaggagcctgagacccccggc
actcgccaacgcccagtgttcactcaacctcttcagaacatcgacagaatcaatgaacac
cagacggctcacttcgaggcacgcttgatcccagtgggagatcccaatctgaaggtggag
tggtaccgcaacgaaaagatcattgaagacagctcccgtatcaccaagcagcacgatttc
ggttttgtgtcgctggacatctcgcatattcgcaaggaggatgagggtgtgtacatgtgc
cgcgccgtcaatcctctgggtgaggcagtaaccaccgcctctatgcgtgtggtatccgag
gccagcatccaaatggatactcagcatccggacagtatcagtcgcatccatcaactggag
aaaccactagccccacgccccactgaaccagagcgcctgtttgagaaacccatcttcact
caactgctcactggaccctcggagctgtgggagggtgctcatgcacacttcgaagctcga
gtcgtgcctgtgggagatccttccctgaagtttgagtggtttatcaacggcgtggagctt
caaatgggctctcgcctgcgcaccacccacgactttggattcgtcaccctggacattact
gcagtggtaccagaggacgccggtgtctacatgtgccgtgcttacaacgccgccggtgag
gctgtatcttctactgccatgaaggttaagaccaagtcgaatattgatggtcagcctttg
atcccggagtcttgggaggctattcgactgaaggaggctgccatgaatcgtgtaccagag
atgtttgttgactcgacaccccaacaagctccggtcttcaccactcatctgcagagctac
gacaagctgcatgagggtcagcacgtcctcttggaagcccaagttgagccccgcgcggat
cctaacctccgcattgagtggtttaagaatggcatttctctaaccactggctcccgaatt
cgcagtacctttgactttggacttgttacactgtccatcaacggattgcgtgctgatgac
tccgctatttacacctgcaaggctaccaaccaggttggcgaggctgtctcaacctcatct
cttaagatcgaagatcgtcactggcttcaggccgagtctctgcacccagattcgttgcct
cgcattggagagcttgaggcgcccaaagagggacgaccagaggctccagagcccacttac
gagactcctgtgtttattactcatcttaacaacattgagtgcaaggagagcgacaatgtg
cgcttcgagtgcaacgtggaaccggctcgtgatcctaccatgtccatcgagtggttctac
aatggacaaccgctgcaggccgctgccaaatttaagtccatctacgactttggctactgc
gctttggatctgaccaactcttatgctgagaacagcggtgtttacacctgtaaggctact
aacagcaagggatctgcaaccacctctggcactctcaagtgcactggtggcaagaccatg
ttcctagacacccagcatccgcagggagaggctggtcttgaggctgtgcaggaaaccgag
gaggagctggccaatcgctacaccagcaaaacggcaaagcccgagacacagtatccacca
ccagtatggacgaagccgctgcaggccgagttccatttgtcggaggcccaacccatccac
ttggaagccaacgtggagcccaaggaggatcccaacctgtttatagagtggtactttaat
ggcaaaatgctgaaccatggctcacgtttcaagatgaccagtgaatttggtttcgttacc
atggatatgatcgaggtatatgcgcgcgatcagggtatctacacatgcaaagcctataac
aaggctggagaggcctttacctccaccaccatcttctgttcgagcaaggagaacatcatc
gagtcaactcagcacccgaagggagctgaaggccttgagcaaatccaggaccttgaagac
tccctgcgcaaggacggctctaagccagaacagccggatctcggcatcccaccacgcttc
accactgaattcgttaatattgcagacatcggggagggtgaattggctcactttgaggca
aatctcatccctgttggtgaccagagcatggtcattgagtggttctacaacggcaaggtt
ttggaggccagccatcgtgtgcgtaccatctacgcttttggcacggttgccctggaggtt
cttggcaccaagatcgaagacaccggcacctacacttgccgcgcgaccaacaagcatgga
actgctgagataagctgcaacctggaatgcgtggacaagccgaggggccagaagccgcgc
ttcacatcccacatccagccgctggagggcctgaaggacggacagtccgctcacttcgag
tgcactctgatcccagtgaacgatccggatctgaaggtggagtggtaccacaatggcaag
ctgatgcgtcactccaaccgcatcaaaacggtatccgattttggatacgttgttttggat
atttcctatctgcaggatcatgacagtggagagtacgtttgcagagcctggaacaagtac
ggtgaggactttacccgtaccaccctcaattgtggaggccgtggcggagtgttctatgat
agcttgcagccggattcactgcagaggattagggagcttgagtgcccacaaggacaacag
gcagatacctccgctcctctggtcgctgagccacccaagttcatcacccagatcgtcgat
gtaactaagctggtggagggacagtcggctcatttcgaggcacgtttgactccaatcacc
gatcctgatttggtggtggaatggtacttcaacggaaagaaactaccccatggtcaccgc
ttccgcaccttccacgacttcggcattgttatcctggatattctgtactgctacgaagag
aactctggtgtatacgaggccagggcccgtaacaagtatggagaggatgttactagggct
tcgctcaagtgcgcctcgaagtcaagcctcattttggactcccagctgcctcgaggaatg
gaaggtggcttggagaagatcgccaacctggagtacagcatggtccgcactcgcgaagaa
accaccgaagagaccaagggcaaggctcccgtctttactgtacccctggaaaacatcgaa
aatctgcgcgagggtgaaaatgcccactttgaagctaggattaccccggccgatgatccc
aaactgaaggtcgagtggtactggaacggtcgtccattgaaggccggttctcgtttccgc
actttctgcgactttggctttgtcattctggagatttctcctgtgtatcctgaggactcc
ggcgagtactcttgccgcgcaatcaacgagtatggtgaggcggtgaccactgccaccatg
aagatccagggtaagcgcagcatcatcatggaatctcagctgcccaagggcatggaggga
actatcgatcgcatcgccgaactggagggcttgggctcccgcagcaccgagttcgtacca
gatgatgatactggcaagccaccagagtttatcacctctcccttcgatatggttatcggc
gagaacgctctggctcacttcgaatgccgtctgcagccgattaatgacccatcgatgcgt
gtggattggttccacaatggcaaggccttgtgggctggttctcgtatcaagaccatcaat
gatttcggattcgtaatccttgaaattgctggttgctatcagcgggattcgggattgtac
acgtgcaaggccacgaacaagcatggtgaggccacggtctcttgcaaattgcaggttaag
ggtcgccaaggcatcgttatggagccccagttgccatccaacttccgcaccggcactgag
agtctgcagaagctggaggagaccatgcataagcgtgaggaacttgtgactgaagacgag
cagcccaatcccccgaaattcaccgaggaaattaaagacaatttggatgttcctgagggt
ggtccgattcactttgactgccgtgtggagcctgtcggcgatccaaccatgcgcattgag
tggttctataatggtcatgttatggctactggatctagggtccatcagctcaacgacttt
ggcttcattgctctggatgtggactacatctatgccagggattcaggcgagtacacttgt
cgggcaaccaacaagtggggcactgccaccactagcgcaaaggtcacttgcaagggaaag
cacaatattgtgtacgagtcgcagttgccagagggcatgacctccgaaaagttgaaggag
ctggagcgtggacgcatcccagaagctccaaaggtggttgaggaggtgtttggaccgcca
aagttcaccacacagatcacttctgtgactgtcgatgaagccgaggccgttcgctttgaa
tgccaggtggaacccaagacggatcccagcctgcgcgtggaatggtaccgcaatggcaag
cccttgccttctggacatcgttatagaaatatcttcgacatgggctttgtttccctggat
attctgtatgtctatggagaggactctggagagtacgtgtgccgtgccattaacaaccac
ggcgaggatcgcaccagagccacagtttcttgcaagaaactccctaccatcttactccag
aaccaagttcctcgcggcatgaagcgttcagatgctctaacccaaatggaagctaccatc
aagaaatatacatccgaagtccatttgacagaggatgatctattcgatcctgatcgcaag
cagcctcctcgctttgtcacccaaatcaaggagcagcttactctaaccgagatggccgtc
accaaattcgaatgccagttggctcccgtgggagatcctaacatgaaggtcgagtggttc
ttcaatggcaagccattgctgcacaagaaccgcttccaacccatttacgattttggttat
gtggcaatgaactttggctgggtttatcccgaagacagcggagagtacgtgtgccgtgcc
accaacttgtatggcaaggacgagacccgtgccatcattaaggtttctggaaagccagga
atcgtctatgactcccagctgcccgctcacatgcagagcattgaccgcatccgcgaaatg
gaagcttcatggcaggtggtgcccgatgaggttgatcccgatgccaagcccagaaccaag
ccagtgtttgtgagcaaactggagccccagactgtggaggagggtgacccagctagattc
tgtgttcgtgtcaccggacacccacgtccgagggttatgtggctgatcaacggtcacact
gtcgttcatggctctcgttacaagctgacgaacgatggtatgttccatctggatgtcccg
aagacacgtcagtatgacactggcaaggtagaggtgattgctcgcaactccgtgggcgaa
tcgattgccaccactgaactgaaggttgttgcacgttcggacgattatcgtaatgtgctg
aagaattcgccacgtccctggtacgattacgaactagctgcctatcagaaggagcgccag
gagaacgagttggaaaaggtattcgatgagcgtaagcaggtcctttccgaacagagctcc
cacacgttgaagggcgtggagcacctgaagcccaagcaatacaagccacccaccccggac
tggcagcaaaatgtcaaggccaagaagagcgaggactactacaacaagctgcagactctg
gaaactgaacagctgctgaaggagaccaacctgcggagggatacccatcagtacgccatt
cccggagagaaggtcgtgagcagttctcaggccaagggaatggcccagtcttacgaagaa
aatcttcaagagaaaacgagcaccactcaagtactggctgctccacccaagggtactgca
caaccatccgaatcatccgtccatggtcgcgaagttcacatgaacaagcagcagcaggtg
cagaaggagatccagggtgaccttgagattacccgcaagataaccgccaccgaaacaacc
gaggttgagcataagggaaccattcaggaacgtgtcgttcagggacccgtgaaaccggcc
aaggccccggtcttcaccaagaagatccagccatgccgcgtctttgagaacgagcaggcc
aaatttgaagtggaattcgaaggagagcccaatcctacggttaaatggtaccgtgagagt
ttccccatccagaactctccggatctgcagatccacaccttcagcggcaagtcgattctg
atcatccgacaagtgttcgtcgaagactctgctgtcttctcgtgtgtggccgaaaaccgt
ggaggaactgcaaagtgcagtgccaatcttgttgtcgaggaacgtcgtcgcgccggaaag
ggtggcattcagccgcctagcttcgtgaccaccatacagagcaccactgtggccaccggc
cagttggctcgcttcgatgccaaggttacgggcactcgcccactggatgtgtactggctt
aagaacggcatgaagattcagccaagcatcaagttcaagatgctggaggaggacagtgtt
cacactctacttatcatcgagccgttcgccgaggattccggccgctacgagtgtgtggcc
gtcaatgccgctggtgaggcccgctgcgatggtgactgcatcgtgcagtcgcccagcaaa
ccggagaaaccaactactccgggcagcgagaaggcgccacatattgtggagcagcttaag
agccagtccgtggaggagggaagcaaggttatcttccgctgtcgagtggatggcaagccc
actcccactgcccgctggatgcgtggcgagaactttgtgaagccatcacgctacttccag
atgagccggcaaggcgagtactaccagctggtcatctcggaggccttccccgaggatgag
ggtacctacaagtgcgtggctgagaacaaactgggcagcattcagaccagcgcccagctc
aaggttcgaccaatcgagaacctggacgccccgcctactatcacagcccttaaggatgtc
tccgttaccgagggcatgcccgctcagtttaagacgacggtgaccggcaaagtgaaagcc
actagcgtccaatggttccgcgaaggtcagctgattcccgaaacaccggacttccagatg
atcttcgatggcaacagcgctgtactcctgattggcaccacatacgaggaggattcgggc
atctttactgtgcgcgtaacctcgtccaccggccaggtcgaatcctcagccaaactgact
gttaaaaaacgacgcatctcggcctttcaattgcgaacgattgattccgccgaggatgag
tcctcttcctctggccgggaggacagtgcccccgagtcgccacacgctttccaacctggc
cagcaaccaggccagcagtttggtcaattcctgggcgtcaacgggcagggtcagcatcag
ggaagatcgcggcaaaagaaacccaaggtacgcagcaagtccctgcagccggctacaaag
gtgataccatggcgcaagtcatcacgtcccactcgaggtcgttccctggacaagggagtc
ttcctgccaggcttcaagcctgaaccggtcaagtcctggactgaggagactattagcttg
aaggctacgccgattgaaaagaaaaagccagcaccaaaacttgaggcagcaaaggttgta
ctgaagtctatcaagaccgaacgtgatcagggcatcatgagtctaggcgctacattggag
cagatcattgctggaaaaaccgaaaaggaagccattccttggatcactatgcgtgaaaaa
cttaaggcagtcgagagtgttcagcaacagctcaacaaattcgatctagatgaggtctat
ctgcaaccacttgaaggccaaattgaaactgaggggcagctgccacaacaggctcaggtg
gagcaggtgcagcgcactaaggaaatccagcgcctgaagagcatggaaagcgttgagatt
atggagatgactgaccagatcgataagctaatcacccagcagcaaaacgctaaagatctc
attccctggaaggagatgcgtcagcagctaaagagtgtccagcgggttaccaagcagatt
gacaagttcaagattgaggaagtcgagctccgtcacctgcaggctcaacaagccatcacg
gaggagtatcaaactggaacagccgaggagactgtcgtcatgattgatgagagctccaag
ggctcgatctctaaagtgattcgtagcgatgatctgctgcagtatgaagatcagtccaat
atctataagcagaagtttgttaccactgaggatgttaacattatgcatgtttcggagcgc
gagaagctagaagctcagagattgttacgcgagcagcaggctgtaaattggcgccagcag
caacagcgcccacagttgcagcccctgacttcggttgaggatacagtaatctctcagact
actgagagacagaagttggtgcaacagcagagcttcatcgaggaggctcagcgccagcag
tttgtgcaggtcgaggactcccagatgatgagcctcgagcagtatgagcatcaaaagatt
ataaaccagcgcacacaacaggaagcgtttagctggcgacagcctcgtgagcctcaaaag
tttattcaggtggaagactcctcgttgcttcacctacaggaacgtcatgatacgcaggaa
cagcagctgctgcaacaagagcctgtcatgtgggaccgtggcagaaaaaagccagatcag
ccacaatatgtgcaaccccaggagcagcgtgttaaagaagaatacgtggagaagccaaaa
acgtacgaggaaatgcacgacgagctggttgaaccaactccgattgaacaacctcagccg
gtgccagttatgtgggagcgaggcaagaagaaaccccagccccaggagaagaccttcgaa
gaggcgcacgacgagttggttgaacccactcctgtccagcaaccggagccagtgcctgtc
atgtgggaacgtggcaagaagaaggcggctcagcaggagacagttttatcccaggaagtg
gtgcaaacatcacaggtagtcgaacagcagatcgttgaggaaacaaagaaaacggctgtt
agacgagtgattccaccaagggagccggagcagaaggtggagcaggttaccttgaaacca
acacctcgccctcgtcctaaggaggctctaaaggctgaggagattcaattgaaacccttc
aggagcaccagacccgtaccacaaccagtggaggcggaacagaaagcctacgaagaagct
accgatgagttgcccgaagaaccactagctccactacaggatcaaccgcagcctgtgatg
tgggagcgtggcaaaaagaagccgcaaaaaccccaagaggaagtgagcgagattccgaaa
actcttgagatttcagtcgacgcgcttgaagaggaagtgccgaagccaacagaaccacag
ccacaacctgttttgtgggctcgtggccaaaagaagcctcaaaagcctgatgagcaaaaa
ccggagcttccaaagagtctggagattgccgtcgacactattgaagaggatcttatcaag
cccgttcagcctgaaccacagcccgttctttgggaacgcggcaagaagaagaaaccgcac
cctcaagacgtaatcgaagaaaagttggatgcagctccgaccaagacatacgaagaagca
gtcgatgttctgcctgatgaacctaaggttgaggagaagccagagcctgtcctatggcag
cgtggtaagaagaagattcccaagtcagagcccactgaagaagtgcatcccgatgaggta
gatgctcaaattgagactgtagttaaggaagatgaagtgattgtcgaagaaaaacgacga
atcaagaaaaccaaaaagcccaagtcgacgaaagaagttaccgaggagttgtttgaggaa
cagccggaagaggaaatatctccagaagaggaagtgccgcagaaagaagttattgaagaa
attgaggaaattgttgaagaaaaacgtaggctcaagaaaacaaagaaacctaagcttaca
cagcaggtgaccgaagaagaaaagcccgatgaagtggtaatcgaagagtctgaagaagtg
gttcaagaacaggaagagatagttgaagaaaagaagaaggtcaaaaaggtgaagaaaccc
aagactgtcgcggagaaacagctcgaagaagacgaaatcccagcagaggagactgttgaa
gaggaagaaactgctgaggaccagcaactagtcgttgaagagagcaaaaaggttaaaaaa
gtaaagaaaccaactcggaaagttgaaaagactgatgttgaggaattgccagcagaggaa
gttccagcagaggaagttatagttgaggaagttccagaagaggtggctccagaagaagag
cccatcgaggaacaggaggaaatcgttgaccaagataatatccaggaacaaaagcgaaag
gtcaaaaaggcaaagaagcccaagaagactatagaaaagaacgaaatagaaagagaagaa
gaccaaccagaagaggaagttccacaagaagaaataattgaggagcaggaagaaataaca
gaaaggcaacgtagattaaaaactatcaaaaagcccaagaaaattgtaaccgaacagaca
gtggaacaggcagagcagacagaaaagccggaagaatcgcaagccgaagaggtgaaagaa
actgtaaccgaagaacctaaaaagcctaagcctgcacctgaagaggcaaaggttgagcaa
atcgaaaagatttcactgaaacctgcgccaagaaaacagcgtcttctgcccgaaaaagaa
caagtggaggaggtcttgcttaagcccttgaaaaagattgctgctgtctcggaagcggaa
caacccgaaacacctgaaacggaattcgaggtgaaagagttcgccatcaccactacagag
gatatagtggatgtaacaaagaagcgtgttaaaaagaagaagcccaaaacaaaggttgca
actgaggaatccactgaagaaccagctgaagaaaccgaagagtttgaagaagacgaagcc
cagcccgaagaagtgcaaccagttgaggaaattccggagcagccacaagtagaggaagtt
gctgacgaacgtaaaacggcacccaagccaaagcctagaaaggaagaaatcatcgagaag
gttgaagaagttgctctaaaacgagtaactcggccaaagaaggagctacctcaagaggcg
accatcgaagaagtgcgtttaaagcctactcaacgcacttctatcaagcccgaagaagtc
aaactagaggaagtggacttgcagcatgtggagaagaaagaggatgaaatcgttcaggaa
gagaagcgaaagacaaggaaggtaaagaagccaaaacacgaagacttgccggaaattccc
gatgctgagccaacgcaactggaagaggctgaacacattgaactggagaagcaaccaaag
cccgaagaagcccagccccaggtgccatggaagagaggtgagaagaaacagcctgttgag
gaagtcctggaggaaaagaaatggccatctggtaaacgccgtccactgcctgaacagcag
ccggaagaagttcaactgaagccaatcccatctaagccaattgaagaaccgcaaaagcca
gaaaaggccatacctggcccgcaacttgtgccagaagaaaagcctgaaagcgaagaggag
gaactcgaacttgaacctctcaagctgcccgaagacaagcagccaaaagagcctaaggct
aagaaagagaagaagaagaagcccaagctgaagaaggccacaccatcagtagatgaggtg
tccgaggaagtcgccgagcccttcgacgagcccattgctgaggaagatgaagtggaagag
atgccagtggacgatgacaaggtcgtggcagtgtcggaagacgtactgcctgaagaggaa
gttgtgcccacggaggagactcccgaggcaaagcagaaggcgcacaagaagcgcacaaag
cggctaaaggaggcctccgtagaagatcaacctcagctgctggaagcggctattgctgaa
atcgaaaaggtggatgaaatatcccaggagatctcacaaaagactattaccctacttaag
aagactgaagacacaagacctcaattcataacgactgaacagcttatcgagctggatgtg
gaggacgtccgacgcgatctggaaatgaaggtcacatcgaacatcattaagaaggagaag
cgtcgcgtggtgctggacgacagtcaaccgttgcctgagctggagttgattacccagaaa
cgaatccaagagggcatagacaaggtggccgatgaggagcttatagaggaccagcagcta
acccaaaaccagcaggagacgactacctctgaagttatcggccaggagcgcaagcttgtc
aagaagaagaagaaggagattaagcctccaaggatcaccgagaaattgcgcccacgccaa
tgtgttcccgaggaacccaccgtgctggagtgcaaagtggaaggagttccgttcccagaa
atcaaatggtacttcaacgatattctcctgtttgcttctgagaagtacgagatcacagtc
atcgagcaagtggcgaagctgaagatcgccaaggtcactcccagtgatgttggcgtctac
acatgcgaggccaagaacgaggctggagtggccacaagtcgtaccaacattattttagaa
aaagaacaaggagttcccccccagtttacaaaacctcttaagattgagtttactgaggag
aagcagcccgagcggcttaaggttacggtgacttgtcaagtgacaggaaaaccgaatcct
caggtcaaatggtatagaggaatagaggaagttatacccagcgaaacagttcagatgttc
tatgatgagaaaaccggcgatgtggccctggaggttattaaccccacacccaatgaagca
gttgtctactctgtgcaggcgcagaatcagtttggacgtgccattggcaatgccaatatc
ctaagccgcgtcgatgaagttccccgggagatactgaaggcacctaccgtaactccactg
agtgctgttgttgtacccacgggtggtactctcttcttccaagccaaatacgatggcttg
cctaggccagaagtgaaatggatgcgcaatggccgcgagattatcgagaatgaggagact
atcatagaaactacagagacaaccaccacaataaaggttgtcaatatgacccgcaaacga
actggcaaatatgaagtttgggcaaagaacaaggtgggtgaagccaagtcctctggttcg
gtggtggtttcagatcaaaagcccgatgagcaaattaagccaccgagatttattcagccc
ttggaacccaagtactttggcgagcacgaggtggccattattgaagcgattgtggagtct
gagccattatcgtccttccaatggtatgtgcacaacgagcccatcaagagttcaaacgaa
gtgcgtatcgttagccaggccaacaagtcaacgttgctgattgaagacttccaaagcaag
tttgtggggccttttacttgccgggccgagaatgtgggtggatcagtgacgtcaacggcc
accgttaacctaattgaatctctgccccaagaggaagccgaggagtttgagtcacctcgt
tttgttgaggagctcgttcaacccgtcgaggttatggatggcgaggcattgctgctgacc
tgtcaagtaacaggaaagcccactcctaaggtagagtggtaccacaatgcggagaagatc
actgaaaataaggaaactacgatatcgcaagacttgcaaggcgtttgccagctgcagatt
acggaagttttccccgaaaacgaaggccaatacgagtgcgtggctacaaataaaattggc
aagagcgtcagcaagacaaacgttaaaatacaagcatttgaatatatccccgattctgaa
atcactggactcacaggatctgaggaggatctacttgatagaaccctctcaatcgacgaa
caagctccgaaaattattaaaaaactaccggagaaaatcgagccaaaagaaggcgagcaa
gcgaagctggaggttaaggtcgttggaaaaccgaaaccgaaggtcaaatggctgcgcgac
gacgagcagatattcgcctccgaggaatatcagatcgaaaatttcgaagacggcacctca
gtgctggtcattaaccacgtctatcccgatgatttgggtacaattagtttcgaggcatac
aatccactcggtgtggcagtgactacggcgctctttgcggtcgaaggcatcgtgggttcg
aaggattaccgcaagccggaatgggtgtctcaaatggaggaaatgcaggtggctctcaaa
gaaacagcaaccactaaagtggaaaaactattcaaaaagcaagaacaagaacatgtgcaa
agtgtagagcaagaagtggaaattcaggttcagactaaacaaattgcgcaaatgaacact
aaaatcaaaaagcataaaaaacacaaacaacaagaacaggatgtttccgagacaacaatt
caatacgaacaaaaagaaacactggctcacgaaacaagcgcgggattaccacaggcagaa
actcttgagcaaattgaagagtctctgcccacatacgaaacactacccatacaaaatctt
tcaaaagacacgcttgaaaccgttgcagttgcagtcaccgcagaactttctactccaaaa
ccaattgcggcgcgggtacaggaggagattctacctgaaaaggtattggccatcaatgag
gaggtgttaccgctcgatgagtttgccctacgaaaagaatctcccagacccgaagaaaac
aagcttaccgaaaatatggaggtaaggctaaagcattcccttaatgtctcacaagcaaag
acggctgagtcttcaaaggaattgccttccaaaataccgaaatccgtgaaagcccagcga
aagatgaaagagtcacgctccttgttggttgaagctccgaacgccgaagaagctatcgag
gatctgaagccactgaaggccgtttcgcagaaggtacatggcgacatattattctcgcat
gagataaccgaggagcagcaccatgctctggagaccattgagaagctaaaacccacctct
gccattgaggacaccgttcagcagaaactactgaaccaggaggagctaattatcgcggaa
gttttaccatccgaaactctgggaagggatgtcactgactttaggccaccgggagaaact
attttgcctcgacttacccccaacatgagtctttacattaccgagtgccagccggaggac
tctataggcgagatgcaacaagctgctaaagaacgtatggagacacctgcgctgtcggta
acggaatcgaaggcagttggtggacaagaactagaagttttggagagcgtcgaccatatc
ccattaataacccagccgactaagggcttagctgattataccattaaagccgaggaggtt
cccgttcaagtgcacgaaattaccacttttgatagtttggaaagagaaacggtgtccaag
acacagactgccaaaagtaatgcattggaattattcgagttagctgagggtctagtcagt
atcaccgctgattctcatagtccaatagccgaggatttgcctatttttgagaaagatgta
aaggaagccactatagatatgcaaatgcagcaccacgtaacaactttcgaaacagtttcc
aatgaaaatgctgttaaggacgtgacagcagctgataccccgaaaatggccgagggcacg
ttggggcaatcaagtgcgttaactattggggaaacgcagcagatgaaccttgtagaaacg
gcagttgagcttatcgaaccaaatgtagaatcaacaaaaccagctaagggcgccttaaca
gaggcatatggcacagccgagagtaacgaagagacgctcctcgaatcactcggtttggta
ccagacgataatcgcaaaacagaacaaggaaaagtaaatattagcgaaggggagtatgtg
gcaaaagttcagaccacgacggtgactgacactgaggaagaatttgtttccgtagctcca
aaactggtagatgccaaattcgatttcgtcgagcaatctgcgttgcagattaaagagaac
acgacagtggagaaagaggaaattctatctcccaatatagaacaggcacctcagttagct
atatcaaatatgtttcctgctgagttaaaggttacaagcatatacgaagttcaaccaggt
gcgacatcaagtaatattattacggaggaaacaaagtctgtatcagctaagcaagtcttc
gagacgatgtcgattggagttactagtaagccagctatgttagagagtactagtcacatt
gatgcctttcaacatcctgagttcagaacgggtgacacagttctagatgaaaaccaacaa
cctttggaagtaacaaacgtgcagataaccgagtcaagtacggatattattgatgtcttt
cctaatcaaaagcttactaaagccgaagctgtcaccgatgcatttaaacatgctgagggc
ctagttgtactttcgatggagtcgacaatcgataaaaccgaagataccaaaccgacggcg
gtaattgcagatataagcatgcatgaacaatttggaacagatgttagagaacaggagccg
ctagaaagtactcaaacacgcacggaggatctaaagcctcagacacaaacaccagaaagc
cagtttggattgctgcaacctctggaaaccagctcatgtgttaccttagagggagaaagc
attctatcagttaaagaaccccattctaaacaaagcgctgccattggaacttcgtcagct
ctgcaagtggccaacatcatgaggccccagcatatggaatctttggagaggctagatgaa
cagaaggtgcctaattatcaggcaaatgttaatattggggaaatcactttaccaaacgtt
gagaaaatcgcttcgtttgatgttctaagcgatttggatacaccagattacaataaatca
tctataagtcgtgtgcagttaattgaaggcacaacatcgttaaaaacgactacagctgtt
gtaagtgaaagtacagaagaattaaaggacctaaacattactcagcctgttcatattagg
ccaaagccttatgaatctgatcagaaaatctccatttccgagcagacaaatgttcttgaa
catgtttcgagcctgagcccagtattacccacattggaaacgatccaatcttcaataaac
agtttacacgagataaatgtaagagagactgatattttagagaaagaggagtccctgaaa
gatgttgatcaaataagtggccgtctggctaaaattgttttggactgcacgtcgggcatc
gcacaagttcgacaagaagaaacactcgagcatgaggaggaccttacatctccctcagtt
ctgccagagaaggcaatacctgcttcttcagagttgcttcggttgcctctaactgaatac
gtgcaagaacaacaaggtaccggtgacatggtggatttcaaagtttcaaacaaatgtgcg
tctcctaaaattgatcacttatatgaaacaaagtcatctgaaatgattgtgtacgactct
tcgacaaattcagttgattccgagttcccagctggtatagtgcctcaaaaatctctggtt
ccctatcggcatacaatggtgacagaaaacgttgcttttcatgcatctgaaaatttagaa
atcttatctgccggtcaacaaattgcaacaaatgtgcaggatagccttagtcaatcgata
atcgcacaggaccaaactacatttgagtctgaacaaaatctgggtctagaaactaccccc
acccaaaaatccaaacttctgaaggatgaccgaaatctttatgctaagctcgtggacgaa
gcaacagtttatgaagccatgggacaggagcaaaaagttaataaatataacatacaacaa
gcggagatcactcacgatctacctcaagtctatgcaaccgatctccaacagacttttgag
gctgaaaaagagattaaaagtcctgagcaatcttatgtggcagcaacaattgatattatt
ccatcgcggcttggtttagcgatgactacaaagacgcaccctgttgaaggaatcgatgtc
ctgttaagttcgcctccaaagccaacgcttgtccagacaaactatgaagaaacaaagcat
catgtacatgtcagagaaactcaagcgatagaggaatccggagaactcatagatggacga
ttacttccagtttctgctgtcgagtcgatagacattacgtttaaggtgacatcagattct
catcaaccaccagttttcgataaggagttgtcaataccgactgtatcccctttggaggcc
agagcaaaaccatctttaaatctacttcaaggcgccaccacattcgatgtcattccctta
gaatcatctgtacttataaaagatacgcatgtcgctgggcagaaggcgcaacaagagtat
gtcgctcaggtggagtcaaataaagttcacgttcaaatggataacctagttatggataaa
gaagatatttttgaaaatgacaaaatggagaatttttgtaaaccaattactgaaggcact
cagcgggaaacagttgttatcgaagtggtgccaatagataatgtgggtggtattcattta
gccccacagccatctacattcttagccactttcacgcctaccgatatattaaatcaatcg
cacgttatagatacacaagttcccttagaaatggaaagtgaagctcaagctgcttacgac
aacattgcccaagctaggattaagtcagctgaagcccacgtacatacaaacgtgtctgag
gttaatgcttacgaacaaactaaagcaattcaaaatcaaagcaagcagggcttatttgct
aatgtatcggaggattctgattcgagcaaagcttatttaacaacaatacaatcgacattc
ttaaaagaggacatcctacccaagcctaacattctccaggatacagctcaagctgctaat
gttgaacttcaatccttggtaaccgaggaagttgtgagcgttagctctatccaagaaaca
tatgaacttcaaattccactgactgaaacagctaacttaactcagcaaactccacagaat
tctgtaaatgtttgtcagcaacttgcttatgaacaaactcctgatattgcgtttgagccg
cacgcattaacacgagcaactactagttctgtaacgacatttcttaagccagccgaaaat
gcaaccgttaatatttatgaaaacattgaagggcatggtgattttaagccggaaactgta
aacctgcgttcaaattcaaatttagattctgagttagtggtttcggtagtacaagaggtg
acatcggtaccatctttaggcagccttgcaacggtcaaaccccaggagttaaaagcagtt
ccagttacaaaatcatccaaaaactttgcttacagcgaggaagaggaaagcccatatgta
cagattactgtagaggaagctaaattggttaacactcgggcaggcgtagaagaaaacaaa
atatcagtcacaacagaacaacccaacacgtgtattgccgcatcgattcaaatgtcaacc
ataagagaagaaaaattagaaaatgctttacaaacttcacaatttgcaccagagtcgatc
cttaaaatttcaccacagatttccccaaatgcacactttgaaaccagaacacacgaagag
gcttattcaacgaccactgagtcactagtaacaacacacgctttaagagatgacattaat
agttctcgaaaaaaagtaatgcaggatgttcaaaagtataaacattttgcgacaaagagc
ttagacaaaacggtaaaagtggacacggtggataaaccaaaggccgataacacagaaacg
gaacacccagtttacattacgacatttaagtctgtacaaaacgaagatggagaaacaacc
atacaaactgaaaacaagcgaatttctcaggaggaaggcatcgttgttgaggaagtcctc
agcgatacagaactcattccagaagacaaaacacaattacaccttgaaataaccgaagtc
agcgaaccaacagaccaatactacaaagagtacactatcactgaacctgaagaggcaagt
gcagacgccttacaaaaaccaactaaagacaaaacaccaaaacagaaaaagacactagaa
actccaattgaggaagttgacgagactgttattgttcatgagggtacaggggaacaaact
gacaagatagctatgaaacgaaaaccaaaaaaggttcagggtaacgttcaggtagaggct
gtcgatgaaaaaccaattgaaaagaaggaaaaggcaaagaaaaagaaagtggttaaaaca
aaacgagatgaaatggatgactacatacaatttctcatacaccaagaaatcccaaagact
gttctacaaccgtaccaacgcacagaaatggaacttccacagagggcacgtcgtgactct
tcttttaagcaaccactcaagcttactccaatgaaaattgagaaagttgagttcaaaaag
cccaaaatggttgaaatcagttcggtggtagagttcccacaaatgcttaaacttaaagcc
cctaaacaacgtcctcaggaagagaaaaagaagaagacagaagcttcatttaaaaacaaa
aagttgaagagctggataagatttgtaccgtatgcaccatactgtttcccgtatgtagtt
accgaattagaaactaatcgcgaagtaggagaactttcacgaaatgttgaagaagcggaa
gaggtactgaaattgcgcccaaggaaatttaggcatccgaagcccgaaaaggctgacctt
gaagaagccgatctaggtacatatgaatctgatcattccgaaaaatcgaacaaggagcta
ttgcacccgaaatacaaacgcgccaaaaagcaaaagagcgaaactccggatgaatcaagg
aaacttaagattggaaagggcaaagttccacaaaatgaggaagcttctgaggaagtcaat
ttgaagccagtaaagcttgatatcgcagagattgaagacggtgaaaagccagtaagacaa
ctggaagaggaagttgtcaagaagaagaagaccaaaaagagttccaagcctcaggaagga
cttcaatttgagcccattgaatttgaagagatggaaagaacctctgatatccgagaagaa
tccgacacatctgtgtctgtagatacttccacgcaggagaagcctatatataaaaagaaa
aagaaggtgacacctagtccacagaaaaaccagtacgaaatattaccagggcaacctagg
gaatttgaagaaaccccagaagatgaccttaaactgcgcaaacgccaaggtgaaaggcct
gatgacgatatggcagataccaaactaaaaccattttataagttcgaagtgcttgatctg
gaacccgaaggcgcccaagctgaaacagtacctttaagtgaaacaatagcaaaggaaccc
aagaaaaagcgaaagattaaggttaagacggaacaagaagataacacaattgaaatcgta
ccactttctcctgtggataacgatgaacaaatctttgaaattacagtcacaagctcagaa
attcttcgagatgacgaaaaagcgaccacaattgctaagaaaaaggtaaagcgaatgaat
aagcaggaattggatgattttgtcacagagttacaggaggaaccaaatcaggaggtctat
gagactaccatgtcagatttctatgaggtaaaactgaccgaattgccgtcagagatggac
aatgataagcctaggaagcgtattttaagacatgaaaagggcgacgaagtccaagttgtg
gaaattgtcgaaggcgtggtggcccccggtgtagaacctttctatgaaataactgtaata
tctagtgaaaataccgaaggagacagcgaagaaataacaactgataagataaaaaagaaa
tccagaaaaatgaaaaagaatgagctcgatgcatatatacagcagctgatcaatgccgaa
ataccagtaactgaactagaaaaatatgaaaaaatcgatgtagatggtaaagcaaagaaa
ccgaaaaagctaaaggcgaagcccgagaaaccaataattgatgaaggcgaaactcttcaa
gttagagtcacagagcatgagccaaccaaaaaattaaaaaccaaaaaaccggtggaaaag
aaatctgtaatagaaaaagaaatgcatgaacaagaagcagttccagaatacgatgagttc
cttatcaacaagactgagtcggaaagtcctcaagaaaaaatcattgaagaaacggaaaaa
gatatcgtgccggtcgtggataaggtcttggcagatttaagtgattgcctaccttttgtg
gtagttgaagaagacttcaagaatatgccattggccaatgatgtaatcgccttagaagat
gagaaaataataaggaaacgaaaggtcagagctaagaaggactcgaaacagtacgaaata
gaaataattgaaaccgagaaacctggtgacatgcctgatgaagcaagggtcatagttata
accacagaagtttctggtgatacaatcgacggacctgctccttctactactgaagcaccg
aaaaaatctgtcagaaaggtgaagaaagaaaaactaaaggagttcattgtcaatgtagtt
gaggaagctccattagatcacttctctgatatatatgaagatgttccaagacctcctgtc
agggaaagctcggagaaagaggatatcggttcatttacaactacggtggttgaggacgaa
atagtagagcctgttctatccgaaaaaataaaatccgtggacgatgttctcgttccaaaa
gacaagaaaaagaaaactgataatcagaaaaagataaaaatatctgaatttgaacctact
ccaacctcagaagactcaactatcgaggaatatacttcaaagctttcagaacatgatgaa
aatctccaagctgatgaatatttggtagacgtgaaagatagtttgccgaaatccaaaaag
aaatctacaaagaagcaaaaggaggaatctctccctggccctatatcgctttataccatt
cgtattgaggagtcaacaccggaacctatcactgaaaaaatatatgaagacgggaaggaa
attgtacgcgtcactaacaaaagaaaaatcaaaaagaaagcggggccgagggaatactta
atcgaagttactgaaacatatgaagataacaatccagaagcagatgttgtcattcgaacc
attgagacaacaccatcaattgattcgaagccgcaggaggaccacaagatacaaatcgta
caggaaaagaagccgaagaccgaaagcttggacaattatattcaaaaactgatagatcaa
gaaattcctcagctagatcataaagaatttgaggctactgtactagagacctctccagag
tctaaaaaggcaaggaaaatcaagaaacatcacaaaaaaactaccgaggttatcgacggc
attccgattactgtaattgaggtaacaatacaagagagtgagcctgatgaagatgacttt
aagccagatgcattcactctagaggaaattgatcatgagaatgcagaggatgctcccaaa
gatcttaaaattaaggtcacagaagagaagcctaaatcaaagaaagaaaaatcgttcaag
tttaaaaccgctgaagaagacaaacctcaaccggtaattgaagaaatatcggaggatgtg
caggttgtacaaataattgaagaagacggcacaccaaaacaagtggaaataaagaaaaag
aaggtatcccgcaaacatggtcctaagaaacaagtctttgaaatcaccgaaacaaaagct
attgatgaacctttggctgaagttactgttgtggagattacagaagaaaagcctgaagaa
gaagtcttagcagctcaagaaaataaatctattaaaaaacaaaagaaactaaagcccgaa
gatgtcaatacttatgttattaaagtccttgaagagttaactgaacccactcaattcgaa
acacttccggaagacgcagatgacaagccacaaccagtaattgaagatatatcggaggat
gtgcaagttgtacaaatacttgaagaagacggcacaccgaaacaggtggaaattaagaaa
aagaaggtttcccgcaagcatggtccaaaggaacaaatctttgagatcatcgaaacaaga
cctagtgatgaaccgttagctgaagtaacaattgtagaactaacagaagaaggcttaaag
aaagacattgttatacctcaagagacgaaaacagtaaagaaacccaaaaaattgaagcct
gaagatatccaaagctatgtcattaatgttctggaagagtttaatgagcctcaatggcct
gagaacaccgaaaaaccaattattgaggaccttgctgaatccattgaaattgtaccagtt
actgaagaagatggcataaccaaggaaattgaggttaagaagaaaaaggtttctcgcaaa
caaggtacgaaaaaacaagtattcgaaatcatagagacaaaaactagtgatgaacctttg
gctgaagttacaatcctcgagctcagtggtgacaagtctcaagaagacattattctacct
aaggagaagaaaccaatcaagaaaacaattaaattgaagcctgaagacgtcgaaagctat
gtcgttaatgttttagaagagttttgtgagccacaaagctttgaaagtcctgagcctact
gatggagaggcacttgaaactagaacaaaaacgaagacgcccaagaagccgattgtgaag
gcaccagaaaatgttatccttatagaagaaatggctcctgaaacggtcatagaaaatatt
gtaaacgaaatgggagaggaagtgaaacaagttaagacaacgaagaaacttaagaaaaag
gaaggccctaaagagtatataattgaaataaaagaaacttatgaagaaaacaagccagaa
ggcgacattgaaataactactacggaaatggttcctgagggctctcctgatgcctctgac
gatcaaccagtcatagttctccagaaagtgaaaaagaagaagcctgttaaggacgatcta
gacaaatacatacaacagttaatcgaacaggaaatcacaaaaactcctctagaagaatat
gaaccaactgaaatggaatcaaagaagaagcccaagaagaaggtcaagtctcaccacaaa
aaaaccattgaagttattgatgggctgccagtaaccatccacgagttcaatgttgaggac
atagttccagaacctgaggatatggaaaaaccaaaaactttgttagacgaaatcaaggaa
ataccacaactgccagacgattcttccgagtaccttgttaacatttctgatgaatttggt
gaagctgataagccaataaaacagcctactgaggatcaacccattaaaaaagaaaagcca
ttaaaaaagaaaaaggtcgttgagactcctgttccattggaagcatatgatcacactgtt
gaagtcgttgctgaacctacgctggagggaacacttaaagaagttactgtcaagaaacga
aaagtatcgcggagaaaggggtctaaagatcacatctttgaaattacggaaacaacaagt
gaggatcaccccacggctgaggttacagttgttgagttgtcaagcgacgagatcttagat
tctgaagaaaagccgaagtatgaaagaaagattgttaaaaagccaaaacagttaaagaag
gatgacgttgaagaatatataattaatattatcgaagaatttatacagccgattccagtt
ggcctagttgaaggtgatgtcgaaaaggtcccgaaggaaaaaactaaaaaaccgaagaaa
tctccgacaacgcacatagccactgaacaagaagacaacaatagcaattacgatgcgttg
gttgaggaagacttagaccaaccgattgagtgcgctttagaaaagccttcaaacccgctt
gaatataccatcagtgtagaagaagaaagcgtcggtgaagaacaaaaacaaccaaagccc
aagaagataagcaagcccaagtccatcaagcagccgtctgtagataaaagcccagactat
ctggtaagggtgctatcttcagaaagcataatagatgaaccaatccctgaagataatgcc
gtaaccgaagctgcagaagataaaccctctgaagaaccaattttccaggtagaagaactc
gaaaccgaagcagtggaaaaagaagttaccgacgataaaggagaaacgacgaagcaaagt
gtaaccaaacgaaaaatcaaaaagcaagttggccccaaggaagaaattattgaaattgtg
gaaattaatacaggtgacactccagagtatgaagtcattgtaactactgagggggttcaa
gagaagaccaaggaagctccagaggagaaaaaagcgaaaacagtccgtaaagcgaaaaag
attccaaaagacgatcttcaggattatattcagaagcttattgagcaagatattccaaaa
actgagctggaaaaatatgaaaaaatagacttggacgagcccataaaaatgaaaagaaag
cctatcaaaaaggtcaagccatctaaggagcaaccgaaagaagaaactgaagagccaatg
gaggataagcccgctgtgaagatttcggaatgctctgaagttggaagtgacgaaccaaag
ctaacggttgctgttaaggaatttattccagaaaagccagaagaaaagccattcgaaata
gtagtacttgaagaaacggtagcaagctatcaggagccagacgaagaaggaaaagtaaaa
gaaaaggtggttaggactaaaaagataaagcagaatagaggcgctgtagaagtagttcat
gacatagtcgaggaaatcgatacggatacaaacgaatccttaataacagtcacgaccacc
gttcccacggagacacctgatcaagaccaaccgtcagttaaacaaaaacgtacaaagaaa
attaagaaagtcgaagttgaagactttgtcaaacgagttattgaggaggaggcaccacag
acggaagagcccgtggacctagtggttatcgaggatgtcgttcccaaaccaagttctgag
aagaggaaaaagaagcccataaaagataagcacacttccgttgaggaagaaacgccacac
gaggatgaagttctcttaattgagtcctttccggaggactctcccgttagtgataatctt
ataactgtggtagaatcagtaccaatcgaagaagaaccagaaaaaatagttgatcaaatt
gaagatactaagaaacccgagaagaaaaagaaaccaatatcttcagctaaaattctagcg
gaaaaagtgttagaagacactgttgaaaagcctttggaggctttacataaggattctgag
ctggaaaacccagatgttcaggaattctgtgtttctattaaggaagaagagcaaaagcat
actcatcctgaaaagaagaagtctcctaaaataactgccgaaaaaccaaatcagccttct
acggagcaatacgaaatatcagtaacgcaacatgagctgaagcctgaagaagaaaagccg
tttacagttcaggtaatacaaagcgaaacaaacgtagaagaaaccaaagatgacaccgga
aaagtacataagcaagttactacgaagcgaatgttgcgacgacctgctggcgaaggtgaa
atagagattattgaagttgttagagatgatcagcctgaggcagaaataactattgtagag
tatgagccagaaccattgaaccaagatgaaaaacccaaagaacctaagaagaaaaccaaa
aaggttaaaaaggatgatatacatgactacatacaaaagttaattgacttggaaacacca
aagacggagcttgaaaagtatgagaaaatcgaattcgaaccaatagtcaaggataagcca
ttggatagtccgatcgacgttttggacgaatcgcccaaagaagtgccgaaaaaagataaa
atttcaaggcctacaaaagttccgaatgaggaaactcctgttgaggatcaatatgcaaag
gtcaaagttgtcgaagaagaagctcccgagcaacccgaaaaaccagtccaaattctagaa
gttaagcccgtagaggtagatgttaaagaggttataactgaagatggcaagccggttcat
gaaaagactaccaagcgagttttaaagaaggtggggcccgaggaacaaacaactttcaag
attacaacaattgaaagcgaggacaacgattctgttacagttattgttgacgaagaacca
gaaatagcttccccacagtctatcaaagaacatctagaacagcctgaggaaaagctggcg
ccaaagcccaagaaaacggtaagaaaggttaaaaaggacgatttacacgaatacgtaaag
aaactaattgaagaagaaattccaaaggttgaccttgaaaaatatgaaaaggtagaaatg
ccagaaaaaccagataaacttgctgtttctgattccattccggaagaaccaaaacctgag
aaaacccaaccaatatcagtactacccgacacaccgaaactcaagaaaacgaagactccc
aagactccaaagacagaagacacagaccagcaagtaccggacgaaccgacagagaccact
gtagacactactgacataccagagcttacaccaacccaaactgcacagcccgaggacaca
gccactgcacaaattacaccaagcgcacaagaagataaatctactcaagatgacactaaa
gatacaattcagaaaacagttaaacataagaaaacaaaaccagacacacaaaaaagcgtt
gaaacaagtgaactaccagaggttcataaagactatcaaattagcatcattcacgaagag
cttgtcgaggaagaccagcccgaaaagattttggaggttagagttatcgatgaagtcgcc
gaggcggaagaatcgcagcccattgtgaaagaggtcgtagaggaggaaccgcagcctgct
acagaagaaactgtagaggacgtcacaaaacccaagtctaaaaagaagaaggtggttaaa
aagaagaccgatgaccatgacgaactcatcaaaaagatgctggagcaggaaattgagaag
acggaactggagaaatacgaaaaaattgaatttgatgttcccaagaaactcaaaccagaa
ttcgctgctcttgaaccaataaaaatagaacgcaaagagcagaagccaacaaaggtgacc
attctcgatgccactgatgttcctaagagcgtgaagctaaaaccaagtaaacgtaaggag
aaacctgccgaagaactgaccgttcaacttccaaagttcagacttaaggcccgtatggtc
atggttgaataccctccggctcccctaattcctaaaactactgatattggcgccattaag
gacaatggagaactgtctcgtaacatagaagaggctgaggaagttctaaagtttaaaccg
cataagactaagaaaattaaaaagatcaaggatgatttagaaaaggtcgagctcgaaaag
tacgaaaaatacattagtagcgaggaagaaccagaggaaaagactccatataagaaaccg
gaaaaggcaccaaaaccagaggaaaaaccagaggatgtaaaacttaagctgggcaagggt
aagaaaaagccaaaggaggaagaagcgcccgaaaatgttactctcaaaaacattccgcaa
aagccacaagaagttgaagaggaagttgaacttaaacagaaaccaaaggaggttgatatt
gttgaggaacaaacaaaggaacccaaggtaggagagttcgttgtgccgccatttgaacca
tctgagtttgatcgtcctgaatatgtacccgatgaacttgagcagatcgaacatccagag
atgcccgagaaagttaagaagccgtctaagactaagtacaagcctaaagataaatctaag
ccagagccggaaaccattgtatcggagattgttgccggagttccaaaggaagaagaggca
attcccgaacaggatgttaagttccgtaagcccgagagagatgctccagaagagaccgat
tctgaaattaagctacggcctatacctcaggcttctaaggatgagaaacctgacgaacaa
gcgctagtaaagcctaaggcagaggagcccattccccaagaaatcgaagataaggccatt
gatgacgaaaagaaaacgaagaaatctaagcccaaaaaagtgcagccgaaggagcaagag
attgcaaaggaagagccccaagaatttgaggtatcggtgaaagaggaagaagctctggtg
gataaacccgttgaaatcgaaaaaccaaaagatgttaaggtgaaagagaagaaacccaag
gaagctcctgtgtccgaagtagtagttcttgaagaagagccaaaaccagaagaagtaccc
gaggaaataccagtggagtacaagataacaactacagtcttggaaccagaggatgcacca
aaggaacatcaagtcaaagtcatcgattttgacgagcgtcaagaaactacggaggaggta
attgaagaaaaggtcgtgacgcgcaagaagaaaccaaagccgcagcaacctgaagagttt
gaggtcaccttaaaggagccaaaagaagaacaattacatccggatgtagtttctgctgaa
atctcgttgccaattgaggagcccgaacggaagccagaagagtatgaggtggaacttaaa
ataactcaaactacaccagaagagcccaaagatgtggaaatcgcagtcaaggaaaaggtc
aagaccaaacctgttaaggaagtcaaggaggataaaattgtcgtggttgaggcagaagaa
gagaagcaaccagttgaggaaacaatcgtggaggttgaagagcaggaagaaaagaagaag
tcaaagaaaccaaaatcctacgagttcaaaatttccgaaacgcaatctattgaagaaaaa
ccaatagaagtggctgaagaagctcctgaggaaaaaccaaaggttgtagagaaaaaggtt
gccgagaaattcgattcctacgaattcactctaaaagaaactgatgaagaaaaggtaatc
acagttgacgaccagcccgaggatgaagcccctgtagaggttgtattcaagaaaaaaccc
aaggaacctgaagcagttgagaccgagtttgtaatgactgaacccaagatcgtggaagaa
acgaccgtggaaactgcaatcaaacagaaaaagacgaaaaaaccgaagaagaacgaagag
gaagctcaattagcaatcaaggttgtcgaaagtgaagccccggttgccgaagaagtgttc
catgaagctcctgagagtgtgattgtagaagaggaagtcattgcagaagaggagcctaaa
gagttcacaattcgcgtttctgaaacagaacgcaagcccgatgagccaagtgtcgagcag
tttaaagttaaaaaacgcaagccctctgttactttcgccgacgaacctgccactgaaatc
gttattaaggaaagcaagcccgctgaagttgtcactgaagacgctcatattaagaccaag
aagccaaagaagaaggtaacggaagtggaagctgaggagctaaagattaagatcactgag
gaagttccacaggaaattcccatagtggaggaggtctcggaggaagaggtgatcactgaa
accaagaagacagctcctgttgttgaagagaagacatacaaaattggcatcaaggaaacg
gagccggaaaaacctgccgaggcaattgtcgaggaggagccggtggtaacagagccaatt
gaggaagcaccgaaaccagaagtctttgaggaacacaaggttagagtcattgaggaaaca
cctcgggaattggttgaggaagtcattgaggaggaggtgaaggtaattcgcagaaagaag
cctaagccagaaattaaggaagaacccgaggcggaagttactgtatctactccaaagcct
gtcgaagaagtggaagccacggccagtattgctgttattccagaacaaccgactgaggag
gatgccgctgatctcaagattacaatcattgaagaagaaacaccaccacaagaactagtt
caggaaattgaagaaattgaaatcgttgaggaaccaaaggcccctgaagaacaaccaacg
gatttcaccttcgtcacaaaggattccgaaaagaagccgactgtggaagagctgcccgag
gaacaggttacgattcaaaagaagaaaaagaaggcgccagaaccagaggtagttgaagaa
cccgaagctgagttcgtggttaaaccgaagacgcctgtccaagaagttactgaagaagct
aagataacgaagaagactaagaaacctgtaaaggaagaagaggccgcggcagagcttaaa
gtaactatcactgaagaaattcccactgaaccagaagtccaagaaattatcgaggaaatc
gaagaggtcgcggaagaaaaaccggcagagtatttggtcgaagttaaggaaagccaacca
gaagctgtagaagaaaaggaagttagcttaccgaaaaagaaactaaaggctccaatagtt
gaagagccagaagctgaagtaactttgaaaccaaagacaaagacggaggaagttcaggaa
gaagcaaagatagtaaagaaaaagccaaagaaaaccgtcgaagttgcagtagccgacgaa
ctcacggtcaaggttgaagaagaggttgtcccagagccgattgtagaagaagaagtagta
gaagaaatccaaattaaaaagaaaccaaaagagccggagccagaggacattgtcgatact
gcggttgtgaaactaaagaaatctgagccagtagatgctgatgatgttgtggctgaagtt
acccttaagccaaaggccaaaaaggaggttactgaggaagaattttctgttgatgttaag
ctgtcaaaggaaaagaagattacagaggaaacttcagaccaaactgtacagctcaagaaa
aagaagaagccgcagaagccggtggaagaggctgcggacgagcttaagctacagcaaact
gttgtcgaggagagacctgtggaaattgaagaagaagagatcgttgaagaagcaatcgtc
gttcgcagaaagccaaagaagcccttcgagccgactgttgaagatctcgaagaaacagaa
ttcagtctctccttcaaaaagccccatacctttaatgagggtgtggaggaggccgccaca
gttctgaaaaaacgaccagtcaagccaactactctcgatgaagctgcagctgaactttct
attaagcgtcaggaagaagaatacgaagagggcgaggatattgaagagttcgtcgtcagt
cagcaaagaaagccaaagcctttgcaaatcacggaagaggatgagcaggcctacacagtg
aagaaactaaagcgtcgaaagcaagtagacattcccgaatacgcagacgttgagaacgtc
acattccgtgcgagaagtaccaagaccaaggaagatgtcgatcaggagttcaacattgcc
ctggactcgtatgctgaggaggaaatttccatgtctggaaaggtgaagttaaagaagcct
atcaagaagaccttctctgaggcagccgatgaagccaggatcaagatcattcaggacttc
gacgatggtgaagaacccattatcgaagaaattcgagacgatgaggataccatcgatgaa
gtcgaggaaccagaagagtactttgttgaggaattgccaccagacgaagtggatttcaag
cttaagccaaagaagcagcccaagccagcctattccattcaagatgaagaggaagaacaa
ttcctgattggcattcgtcatcccaaacgcgattcggttacatacgacgaggactctctt
acctttaaaaagaagcgtaaggttgtgcaacaacttttcaatgaagatggagcttctctt
aatattaccagagaaatgaacgttgaagaatctgagaatctcaacgtaatgtactctatc
tgcaactatattgccgacaacaatgaggctataaacctagtcgagggtgagaaggtgacg
gtcgttgggcgtcacagctctgagtggtggtacgtcaagaaaagcactacggaagaggaa
ggatgggttccagctcaatatctgatggagcccgaggaatacgcgcagtatgtgcaaaac
aagctgcacgagaaaatcgataagctgcccgtatttgaacgtcctggaccagaagacaag
cccattgccccaagatttattgagaaactacagccgattcatactcctgacggctacacg
gtgcaattcgagtgtaaggtcgagggcaatccacgaccacagattgcctggttccgcgaa
actgctattatcaagccctcccaagacttccaaatgttctatgatgatgacaatgttgca
accttgatcattcgcgaggttttccccgaggatgccggccaattcacagttgtagcaaag
aatgctgctggattcacttccagcacaacggaactgattgtagaaagtccactatctgat
cacggctctgacgccacagccctttcacgacgcagcatgtctcgtgaatcctcgctggct
gacattttggagggcattccaccaacattctccaagaaacccaaggctcaatatgtggac
gagaatacaaatgtgattcttgagtgccgactggtggccgtgcccgaacccgatattgtc
tggacctttaatggcgaagacattgacgaagaagagattaaaaacgttcgcatcgtcacc
gaatccgacatgcacatgtactgcagtgtggtgcacatctccaaggtgaagaaatcgcaa
gaaggtacctacgaggttattgcaacaaatcgcgagggcgaggcacgtctgccaatcacc
ctcaaggttcgcaccaccgacaaggaggcaccgcaaattctggaacccttgcgcaacatg
gttatacgtgaaggcgagagtgtcgtactatctacgcaaattgtaggtaatccaccgcca
aaggtaacttggtataaggatggcaagcccgttaagaacgccaagtccgacaaggatttg
cataccctgacacttataacaccacaaaagtctgagaagggtgaatacacggtaaaggct
gtaaaccccttgggtagcgtggagaccacagctaatctaacaattgaagagcctgctggc
ggtaatgctgagccaccacttttcgtggaacggtttgaggagcagaatgttccgcaaaag
ggcgaaattcgcttgccagccaaggtttccggtaacccggtgcctgaggttcaatggctc
tttaacaacacaccattgttccccagcgagcgcatccagcaggtttacgatggcgagaac
atcgagcttatcatcaaggatgccaacccagaaaccgattcgggagactacaaatgtatt
gcaagcaatcccataggtaaaacttcccacggtgcccgtgtgattgtcgaggtcgatgaa
gtgacgtttacgaagaagcttaagaagaccatcaccattgaagaggtgcaatctctcacc
ctggagtgcgagacctcccacgtagttaccaccaagtggttctttaatggcaaggaactt
agcggaatggatcatcgcgtcgtggttgaggatggcaagactcacaagttggtgatcaga
aacacgaatctacgtgactctggaacctatacttgcaaggttaaaaagcaagaaactcaa
tcgactgtcgaggtgttgcaacgtaagccggactttatcaaggttctggaggattacgag
gtaaccgaaaaagataccgccattttggatgtggagcttactactgaggcgactgaagtc
acttggtacaaggacggcgagaaaatcacacaagaaaacaagaacgtcgagttcatcaaa
gatggaaaggctcgtcggctggttatccgcgatgccaccatccacgacgagggtcagtac
acatgcaagatcgagggacaggagtgtagctgtgagctagttgtaatcgagctaccacct
gaaatcgtggagccactgaatgacgttgcagtgaccaagggcgagaatgctgttttcgag
gttgaacttagcaagggcgatgccctagtcaaatggttcaagaacggcaaggaaattgtg
ttcaatgagcgtattcaactggccatcgatggcaagaaacaatccttgcgcattgtcaaa
gccaagcccgaagatgtgggtgaatactccgttcaggtgggcgagcatacatcaaaggca
aagttgacagtagaggagcctctcgtagacttcgtcatccgcctgccggatatcacgctt
gccaccaagacaacggatgccgagttcacggtgcagttatcacagcccgatgtcgaggta
acctggtgcaagaagggcaagccaatcaagcccaaccagaagcacgaggtattcgttgag
ggcactgtccgccgactggtcatccacgatgctagcgacgaagatgccggtgagatcagc
tgcgttgcagagaacgtcacaagcagcactaagctgtgcgtcgaggagctcaagctgcca
cccgtcattacctctgacaaggatcagaccatcaaggttaaggagaacgacgacgtaacc
ttctctgtcaagtacacaggcgtgccaacccctgaggcctgttggaccacgcgcaaggtt
gtcgtacccaagtcaaagcggacaatcccgaccatcgatgagcagtcagccacgctaacc
atcaaaaaggttgttgacgatgacgagggcgaatacaccgtcaagcttgtcaacccggtt
ggcgaggcggaggccagcctccatttggtcataatgcgcaagccaacggcacctggcaca
ccccaaccccttgagataatgcatgactctataacgctctactggaaggcgccagaggat
gatggcaagtcggagattattgagtacattctagagtatcacgatgttaaggaagaaaaa
tggactgaaattagaaagatcaaggacaccacgtataccataagcaagttgaagatcgac
acggagtacgtcttccgttcgattgccgtaaacgaagtgggaccatcgccgccctctccg
ctgtcgccacccatccgactggtgcccaaggttgagaccaaggcgcctagcgtacaagaa
ccactacaggatgtggttagcgaactggacaaggaggtgactctgtcctgcgtgttcggt
ggcattccagagccaaaggtgacgtggaagaagaacggtcaggtgttcgaatcgagcagc
atacgctacgaaaatcgcgtggccaagtacaccattgaaaagacaaccattgagactgaa
gccacctacacgtgcgtggcgaccaatgagaagggctccgcggagacctcgtgtcgccta
aaactgcagcagaaaccggtcctcgaggtggaggacaagtacttgacgcagaagctgcgc
acgggcagcactctcaccattccagcgacggtccgcggctatccacagcccactgtgacc
tggcacaaggagacgatcgagcagaagaccaccaagtcggtaaccattgagaccacggag
accacttccacttacacagtaaagaaggtgacccgcgaacaatccggcaagtacaaggtg
accgccaccaatgagtcgggcactacgtacgtagagtgcactgttcaggtgatcgataaa
cccagcagaccccaatctctggagatcaaggacattaaaaaggactccattatcctagag
tggaccccaccagtcgatgatggaggtctggatattgaaaagtatacgctggagaagtgc
gacgttcaaaacaatgtttggatgaaggtgtccgactttaacaaagacattaaatcgtat
gctgttcaaaaactgtcgatgaacgcgcaatacatgttccgtgtggtggccgctaatcct
attggcgagtctgagccaacggaaagtgatccagttactattacgaagaaattcgaaaaa
ccatcgcctcctcgtggtcctaccacagtgtcgggcatgaacgacacctccttcaatttg
gcttgggagccatcggagaccgacggcggttcaaagatcatagagtatattgtggagata
agggaagagactgaaaccacctatcgatcggtgggcgtaaccctgggcactgtgaccaac
atccacgtaaagaaggttgtcaggaacaagggctacttcttccgcatatatgcgagaaac
gaggttggcaccagcgaggcgtttgagaccacggagaagattgtcatgggccgcaaaatt
acgccgccatcgccacctcaaaacttgagggccccagatgtcaccagccgaagtgttaca
ttggattgggaggtgccagctcgcaacggcggatcagagatcacgggctattgcgtggag
aaacgttcctcaacatctacaaactggacaaaggttattacactggatgctcaccagctg
cactacacgattgacaatctgaaagagaagtgcgagtactggttccgtgtgtcagcggag
aatgaggttggattaggtgcaccagccgtcaccgagagcatatcgctcaagacacatgca
agtgagttcatattggtagttcgtaattgtggatcccatactgaatttggtttccttaaa
gccgtaccctcaccacccaccggcccactggaggcgcgcgttctcgccgccaatgcccac
atattcgaatggggtttacccgagtcagatggaggtgcgcctctgctcggctaccacatt
gctatacgtgacatgaagaagaccatgtggatcgaggtgggtcgtgtgccagctggcgtg
cagaagttccagatcagagacctgcaggagaaccacgagtacatgattcgcatattcgcg
aagaacgagattggtctgagtgaacctctggaatcggaggagccctacaaggctatgact
gctggtcatgagagcctgccggacgagccgcgcacggagatgagttcgtgcaacacctcc
tcgtggctgcgtgaccaccacatggatgcggatatccattcgtatgcccgcggcaggctg
cttcaacgcgatgagtacttcttccggttgtgggcggaactgcccaagagcaaaaagaag
aagagctccaaatag

DBGET integrated database retrieval system