KEGG   Aromatoleum aromaticum: ebA2406
Entry
ebA2406           CDS       T00222                                 
Name
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE ATPase_2 T2SSE AIG1 DUF4913 TrwB_AAD_bind AAA_16 AAA_10 AAA_7 DUF87
Other DBs
NCBI-ProteinID: CAI07468
UniProt: Q5P5E4
Position
complement(1435588..1438476)
AA seq 962 aa
MASSVPFLRARQAVTPNGAEVPADDAWTRHVSTLAAHGIAEPGCPLNGDRPKPATEADAQ
ALYEVAQSFADLLPWVEYLPESKSMLLEDGQSVAAFFELAPVGTEGREMAWQWQARDALE
NALQDSFDELDENPWVVQLYAQDEANWDSYLRTLAGYVQPRAQGSAFSEFYLRFFAHHLR
AIAKPGGLFEDTTVTRLPWRGQVRRVRMVVYRRSPLTTSPRRGLSPEQALTTICDRLAGG
LANAGVKARRMEAANIHDWLLRWFNPHPTLLGPSAEDRERFYALTRYPEEQEEGEIELAS
GDFAQRLFFGRPRSDVTNGTWLFDGLPHRVIVMDRLRMAPPTGHITGETRKGGDAVNALF
DQMPEDTVMCLTLVATPQDVLEAHLNQLSKKSVGETLASEHTRQDVQQARSLIGSTHKLY
RGALAFYLRGRDLAQLDARGLQLVNVMLNAGLQPVREEDEVAPLNSYLRWLPCVFDPALD
KRQWYTQLMFAQHAANLAPVWGRSLGTGHPGITFFNRGGGPITFDPLNRLDRQMNAHLFL
FGPTGSGKSATLNNILNQVTAIYRPRLFIVEAGNSFGLFGDFAARLGLTVHRVKLAPGAG
VRLAPFADAHRLVETPSQVQTLDADDLDEDRDEAAQVAEADEQRDVLGELEITARLMITG
GEDKEEARMTRADRSLIRQCILDAAQRCVAEKRAALTRDVRDALRERARDATLPEARRTR
LLEMADAMDMFCQGVDGEMFDRPGTPWPEADITIVDLATFAREGYNAQLSIAYISLINTV
NNIAERDQFLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWYWLATQNIDDLPK
AVEPMLNMIEWWICLSMPPDEVEKLARFRELKPAQKALMLSARKEAGKFTEGVILSKSME
VLFRAVPPSLYLALAQTEPEEKAERYQLMQQYGISELDAAFKVAEKIDQARGIASLALDM
LT
NT seq 2889 nt   +upstreamnt  +downstreamnt
atggcctcgtccgttcctttcttgcgggcacgtcaggccgtaacgccaaacggcgcggag
gtgccggccgacgacgcctggacccggcacgtgtcgacgctggccgcgcatggcattgcc
gagcccgggtgccccctgaacggtgatcgccccaagcccgccaccgaggcggatgcccag
gcactctatgaagtggcccagtccttcgccgatctgttgccctgggtggaatacctgccc
gagtcgaagagcatgctgctggaggacggccaatcggtcgcggccttcttcgagctggca
ccggtcggcaccgagggtcgcgagatggcctggcagtggcaggcgcgcgatgcgctggag
aacgcgctgcaggactcctttgacgaactcgacgaaaacccctgggtggtccagctctac
gcccaggatgaggcgaactgggacagctatctgcgcacgctggcaggctatgtgcaaccg
cgtgcccaaggcagtgctttcagcgagttctacctgcgcttcttcgcgcatcacctgcgc
gccattgccaagcccggcgggctgttcgaggacacgacggtgacgcgcctgccgtggcgt
gggcaggtccggcgggtgcgcatggtggtctaccggcgtagccccctgactacgtctccc
cgccgcggtctgtcgcccgagcaggcgctcacgacgatctgcgaccgcctcgcaggcggg
ctcgcgaacgcgggcgtgaaggcccgccgcatggaagcagccaacatccacgactggctg
ctgcgttggttcaatccccatccgaccctgctcggcccgagcgccgaggatcgggagcgc
ttctacgcgctgacccgctatccggaagaacaggaagagggcgagatcgagctggccagc
ggagacttcgcgcagcgtctcttcttcgggcggcctcgctcggacgtgacgaacggcacc
tggctcttcgacgggctcccgcaccgggtgatcgtgatggaccggctacgcatggcgccg
ccgacgggccacatcaccggcgaaacccgcaagggcggcgatgcggtcaacgcgctgttc
gaccagatgccggaggacacggtgatgtgcctgaccctggtcgctacaccccaggacgtg
ctggaggcacacctgaaccagctgagcaagaagtcggtcggcgagacgctggcctccgag
cacacccgccaggacgtgcagcaggcgcgcagcctgatcggcagcacgcacaagctctac
cggggcgcgctggccttctacctgcgcgggcgcgatctcgcgcagctcgacgcccggggc
ctgcagctggtcaatgtcatgctcaacgccggcctgcagccggtgcgggaagaggacgag
gtggcgccgctcaacagttacctgcgctggctgccctgcgtcttcgacccggccctcgac
aagcggcagtggtacacccagctcatgttcgcgcaacatgcggcgaatctggcgccggtc
tggggccgcagcctgggcacggggcatccgggcatcaccttcttcaaccgtggcggcggg
ccgatcaccttcgatccgctgaatcgtctcgaccggcagatgaatgcgcacctgttcctc
ttcggccccaccggctcgggcaagagcgcgaccctcaacaatatcctgaaccaggtgacg
gcgatttatcggcctcggcttttcatcgtcgaggcgggcaacagcttcggcctgttcggc
gacttcgcggcgcggctgggcctcacggtgcatcgtgtgaagctcgcgcccggtgcgggg
gtcaggctcgctccgtttgcggacgcacaccgcctggtggagacacccagccaggtccag
accctggatgcggacgacctggacgaagaccgggacgaagcggctcaagtcgccgaggct
gacgagcagcgcgacgtgctgggcgagctggagatcaccgcgcgcctgatgatcaccggc
ggcgaggacaaggaagaggcccgcatgacgcgcgccgatcgcagcctgatccgccagtgc
atcctcgatgcggcgcagcgctgcgtggcggagaagcgcgcggcgctcacgcgcgacgtg
cgcgatgcgctgcgcgaacgtgcccgcgatgcgacgttaccggaggcgcggcgcacccgg
ctgctggagatggccgatgcgatggacatgttctgccaaggcgtggacggcgagatgttc
gatcgtcccggcacgccctggcccgaggccgacatcacgatcgtcgatctggcgaccttc
gcccgcgagggctacaacgcgcagctctcgatcgcctacatcagcctcatcaacacggtg
aacaacatcgccgagcgcgaccagttcctcggccggcccatcatcaacgtcaccgacgag
ggccacatcatcaccaagaacccgctgctcgcgccctacgtggtcaagatcaccaagatg
tggcgcaagctcggggcctggtactggctggcgacccagaacatcgacgacctgccaaag
gccgtcgagccgatgctcaacatgatcgagtggtggatctgcctctcgatgccgcccgac
gaggtggagaagctcgcgcgcttccgcgagctgaagccggcgcagaaggcgctgatgctc
tccgcccgcaaggaggccgggaaattcaccgaaggcgtgatcctgtccaaatcgatggaa
gtgctgttccgcgcggtgccacccagcctgtacctggcgctcgcgcaaaccgagccggaa
gagaaggccgagcgctaccagttgatgcagcagtacggcatcagcgagctggatgcggca
ttcaaggtggccgagaagatcgaccaagctcgcggtatcgcgtcacttgcgctcgatatg
ttgacgtga

DBGET integrated database retrieval system