KEGG   Gallus gallus (chicken): 395655Help
Entry
395655            CDS       T01006                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
gga  Gallus gallus (chicken)
Pathway
gga04330  Notch signaling pathway
Module
gga_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:gga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    395655 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank_2 Ank NOD DUF3454 NODP Ank_5 Ank_3 Ank_4 cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 395655
NCBI-ProteinID: NP_001025466
CGNC: 49424
Ensembl: ENSGALG00000002375
UniProt: F1NZ70
Position
17
AA seq 2561 aa AA seqDB search
MGRCSAAHPRGGVHCPGLCAVPDALLLFPGVRCTQLAESCLNGGKCETFLNGTEVCQCSS
AHMGERCQLPNPCLSSPCKNAGTCIPLLRGSTADYTCVCRLGFTDELCLTPLDNACLNNP
CRNGGTCDLVTLSEYKCRCPPGWSGKTCQQADPCASNPCANGGQCVPFEAHYICRCTAGF
HGANCKQDVNECNISPPVCKNGGSCTNEVGTYQCSCKPAYTGQNCEHLYVPCNPSPCQNG
GTCRQTGDTTYDCTCLPGFTGQNCEENIDDCPGNNCRNGGTCVDGVNTYNCQCPPEWTGQ
YCTEDVDECQLMPNACQNGGTCHNNHGGYNCVCVNGWTGEDCSENIDDCAMAACFQGATC
HDRVASFYCECPHGRTGLLCHLDDACISNPCNEGSNCDTNPVNGKAICTCPSGYMGPACN
QDVDECSLGANPCEHAGKCINTQGSFQCQCLQGYSGPRCEIDVNECLSNPCQNDATCLDQ
IGEFQCICMPGYEGVYCEINTDECASSPCLHNGNCLDKINEFHCECPTGFNGHLCQFDID
ECASTPCKNGAKCVDGPNTYSCECTEGFSGVHCEIDIDECNPDPCHYGTCKDSIAAFTCL
CQPGYTGHRCDININECQSQPCRNGGTCQDRDNAYNCLCLKGTTGPNCEINLDDCASNPC
DYGKCIDKINGYECTCEPGYTGRMCNINIDECASNPCHNGGTCKDGINGFTCLCPEGFHD
PKCLSEVNECNSNPCIHGRCHDGLNGYRCDCDPGWSGTNCDINNNECESNPCMNGGTCKD
MTSGYICTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYTCNCLLPYTGATCEDVL
APCAGGPCKNGGECRESEDYKRFSCSCPPGWQGQTCEIDINECVKSPCRNGATCQNTNGS
YRCLCRVGFAGRNCDTDIDDCQPNPCHNGGSCSDGIGTFFCECLAGFRGLKCEEDINECA
SNPCKNGANCTDCVNSYTCTCPSGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCLCP
SGFTGSYCEHNINECDSKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKN
GGKCWQTNNLYRCECNSGWTGLYCDVPSVSCEVAAKQQGIDVAHLCRNSGLCVDSGNTHF
CRCQAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSH
PCQNGGTCIDLINTYKCSCPRGTQGVHCEINVDDCSPFFDPVTLGPKCFNNGKCTDRVGG
YSCICPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDYKCECRPGYAGRRCDTVVDG
CKGKPCRNGGTCAVASNTGRGFICKCPPGFVGATCENDSHTCGTLHCLNGGTCISMHKSS
KCVCAAAFTGPECQYPASSPCISNPCYNGGTCEFLSDASPYYHCNCPANFNGLNCHILDF
DFQGGFGQDIIPPKIEEKCEIAVCASYAGNKICDGKCNNHACGWDGGDCSLNFNDPWKNC
SQSLQCWKYFNDGKCDSQCNNAGCLYDGFDCQKYEGQCNPLYDQYCKDHFSDGHCDQGCN
NFECEWDGLDCANNMPEKLADGTLVVVVLITPENLKNNSFNFLRELSRVLHTNVVFKKNA
KGEYMIFPYYGNEEELKKHYIKRSTEDWADMSSAVINKVKSSLYSRAGRRQKRELDQMDI
RGSIVYLEIDNRQCIQSSSQCFQSATDVAAFLGALASLGNLNIPYKIEAVKSETAEPARN
SQLYPMYVVVAALVLLAFIGVGVLVSRKRRREHGQLWFPEGFKVTESSKKKRREPLGEDS
VGLKPLKNASDGTLMDDNQNEWGDEETLDTKKFRFEEQAMLPDTDDQTDHRQWTQQHLDA
ADLRISSMAPTPPQGEIDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEDDAPAVI
SDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVS
ADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINCHADVNAVDDLGKS
ALHWAAAVNNVEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDIT
DHMDRLPRDIAQERMHHDIVRLLDEYNLVRSPPLHSGPLGAPTLSPPLCSPSSYIGNLKP
AVQGKKARKPSTKGLSCNGKDSKDLKARRKKSQDGKGCLLDNSSVLSPVDSLESPHGYLS
DVASPPLMTSPFQQSPSMPLNHLPGMPDAHMSINHLNMAGKQEMALGGSGRMAFEAVPPR
LSHLPVSSPSTAMSNAPMNFSVGGAAGLSGQCDWLSRLQSGMVQNQYGAMRGGMQPGTHQ
QAQNLQHGMMSSLHNGLPSTSLSQMMSYQAMPSTRLASQPHLLQNQQMQQMQQPGMQPQP
GMQPQPGMQQPQQQPQQQPQPQQHHNPGSNASGHMGQNFLGTELSQPDMQPVSSSAMAVH
TILPQDSQLLPTSLPSSLAQPMTTTQFLTPPSQHSYSSPLDNTPSHQLQVPDHPFLTPSP
ESPDQWSSSSPHSNVSDWSEGISSPPTSMQSQMGHIPEAFK
NT seq 7686 nt NT seq  +upstreamnt  +downstreamnt
atggggcggtgtagtgctgcccatccccgcggtggggtgcattgccccgggctctgtgct
gtgcctgacgctctccttctgttcccaggtgtgcggtgcacgcagctggccgaatcctgc
ctcaacgggggcaagtgtgaaactttcctcaatgggacggaggtgtgccagtgcagcagt
gcccatatgggcgagcggtgccagctgcccaacccctgcctcagctccccctgcaagaac
gccggcacctgcatccccctgctgcgtggcagcaccgccgactacacctgtgtctgccgc
ctgggcttcaccgacgagctgtgcctcacacccctggacaacgcctgcctcaacaacccc
tgccgcaacgggggcacctgtgacctggtgacactcagcgagtacaagtgccgctgcccg
ccgggctggtcaggtaaaacctgccagcaggccgacccctgtgcctccaacccctgtgcc
aacgggggtcagtgcgtccccttcgaagcccactacatctgccgctgcacggccggcttc
cacggggccaactgcaagcaggacgtgaacgaatgcaacatctcaccaccagtctgcaag
aacggtggcagctgcaccaacgaggtgggcacctaccagtgctcctgcaagccagcctac
accgggcagaactgcgagcatctctatgtgccctgcaacccctcgccctgccagaatggg
ggcacgtgccgccaaactggggacaccacctacgactgcacctgtctgccagggttcacc
gggcagaactgcgaggagaacatcgatgactgtccagggaacaactgcaggaatgggggc
acctgcgtggatggcgtcaacacctacaactgccagtgcccgcccgagtggacaggtcag
tactgcaccgaggatgtggatgagtgccagctgatgcccaacgcctgccagaacgggggc
acctgccacaacaaccacggcggctacaactgcgtctgcgtcaatggctggacgggtgag
gactgcagtgagaacatcgatgactgcgccatggctgcctgcttccagggggccacctgc
catgaccgggtggcctccttctactgcgagtgtccccatgggcgcacaggtttgctgtgc
cacctggatgacgcctgcatcagcaacccctgcaacgagggctccaactgcgataccaac
cctgtcaatggcaaagccatctgcacgtgtccttcggggtacatggggccggcgtgcaac
caggacgtggatgagtgctcactgggagccaacccctgtgagcacgcagggaaatgcatc
aacacccaggggtccttccaatgccagtgtctgcagggctactcgggcccccgctgcgag
atcgatgtcaatgagtgcctctccaacccctgccagaacgatgccacctgcctggaccag
atcggggagttccagtgcatctgcatgcctggatacgagggcgtctactgtgaaatcaac
acagatgagtgtgccagcagcccctgcctgcacaatggcaactgcctggataagatcaac
gagttccactgcgagtgccccactgggttcaacgggcacctgtgccagtttgacatcgat
gagtgtgccagcaccccctgcaagaatggggccaagtgcgtggatggccccaacacctac
agctgcgagtgcaccgaaggtttctcaggtgttcactgtgagatcgacatcgatgagtgc
aaccccgacccgtgccactatgggacctgcaaggacagcatcgccgccttcacctgcctc
tgccagcccggctacacgggccaccgctgcgacatcaacatcaatgagtgccagagccag
ccctgcagaaacggggggacctgtcaggacagggacaacgcctacaactgtctgtgcctc
aaggggaccacggggcccaactgcgagatcaacctggacgactgcgccagcaacccctgc
gactacggcaagtgcatcgacaagatcaacggctatgagtgcacctgtgagccggggtac
acagggcgcatgtgcaacatcaacatcgatgagtgtgccagcaacccatgccacaatggg
ggcacatgcaaggatggcatcaacggcttcacctgcctctgccccgaaggcttccatgac
cccaagtgcctgtccgaagtgaatgagtgcaacagcaacccctgcatccacgggaggtgc
cacgacgggctgaacggttaccgctgtgattgcgacccgggctggagcgggacaaactgt
gacatcaacaacaacgagtgtgaatccaacccctgcatgaatggtggcacctgcaaggac
atgaccagcggttacatctgcacctgcagggaggggttcagcggacccaactgccagacc
aatatcaatgaatgtgcttccaacccctgcctgaaccaaggcacgtgcatcgatgatgtg
gccggctacacctgcaactgcctcctgccctacacaggagccacctgtgaggacgtgctg
gccccctgcgccggcggcccctgcaagaacggcggcgagtgccgggagtcagaggactac
aagaggttctcgtgcagctgcccgcccggctggcaaggccagacgtgtgagattgacatc
aatgagtgtgtgaagagcccgtgccgcaatggggccacgtgtcagaacaccaacgggagc
taccgctgcctgtgccgggtgggcttcgcgggccgcaactgcgacaccgacatcgacgac
tgccagcccaatccgtgccacaatggtggctcctgctcggatggcattggcacattcttc
tgtgagtgcctggccggcttccgtgggctcaagtgtgaggaggacatcaatgagtgtgcc
agcaacccctgcaagaacggggccaactgcaccgactgcgtcaacagctacacctgcacc
tgcccctccggcttcagcggcatccactgcgagaacaacacaccagactgcactgagagc
tcctgcttcaatggggggacctgcgtggatggcatcaacaccttcacctgcctctgtcca
tccggcttcacgggcagctactgtgagcacaacatcaacgagtgtgactccaagccctgc
ctgaacgggggcacgtgtcaggacagctatgggacgtacaagtgcacctgtccccaggga
tacactgggctcaactgccagaacttggtgcgctggtgtgactcctcaccctgcaaaaac
gggggcaagtgctggcagaccaacaacctgtaccgctgcgagtgcaacagcggctggacg
gggctctactgtgatgtccccagcgtctcctgcgaggtggctgcaaagcagcaaggtatc
gacgtcgctcatctctgcaggaactcagggctctgtgtggacagtggcaacactcacttc
tgccgctgccaggctggctacaccggcagctactgcgaggagcaggtggatgagtgctcc
cccaacccctgccagaacggagccacctgcaccgactacctggggggctattcctgtgag
tgcgtggctggttatcatggagttaactgctcagaggagatcaatgagtgcttgtcccac
ccatgccagaatggaggaacctgcatcgatctcatcaatacctacaaatgctcctgcccc
agaggaactcaaggggtgcactgtgagatcaatgtggatgactgcagccctttctttgat
cccgtcaccctggggcccaagtgctttaacaatggcaagtgcacggatcgggtaggtggc
tacagctgcatctgcccccctggctttgtaggggagcgctgcgagggagacgtcaacgag
tgcctctccaacccctgcgacgcgcgcggcacccagaactgcgtgcagcgggtcaatgac
tacaaatgcgagtgccggcctggctacgcagggcgtcgctgtgacaccgtggtggatggc
tgcaagggcaaaccctgcaggaatgggggaacgtgcgctgtggccagcaacaccggccgc
ggcttcatctgcaagtgccccccgggctttgtgggtgccacctgcgagaacgactcccac
acctgcgggaccctgcactgcctgaacggtggcacctgcatctccatgcacaagagctcc
aagtgtgtgtgcgcagcggccttcacgggccccgagtgccaatacccggccagcagcccc
tgcatctccaacccctgctacaacgggggcacctgcgagttcctcagcgacgcctcccct
tactaccactgcaactgccccgccaacttcaacggcctcaactgccacatcctcgacttt
gatttccaaggcggcttcgggcaggacatcatcccacccaaaatcgaggagaagtgtgag
atcgccgtttgtgcgagctatgctggcaataagatctgtgatgggaagtgcaacaaccac
gcctgcggctgggacggcggcgactgctcgctcaatttcaacgacccctggaagaactgc
tcacagtcactgcagtgctggaagtacttcaatgatggcaagtgtgactcgcagtgcaac
aacgcgggctgcctgtatgatgggtttgactgccagaagtacgaggggcagtgcaaccct
ctgtacgaccagtactgtaaggaccacttctcagatggtcactgtgaccagggctgcaat
aactttgagtgtgagtgggacgggctggactgtgcaaacaacatgcccgagaagctggcg
gatggcacgctggtggtggtggtcctcatcacccctgagaacctgaagaacaattccttc
aatttcctgagggagctgagccgtgtgctgcacaccaatgtagtcttcaagaagaacgcc
aagggagagtacatgatcttcccatactatggcaacgaggaggagctgaaaaagcactac
atcaagaggtcaacggaggactgggcagatatgtccagtgctgtcatcaacaaggtgaag
agcagcctctactcgcgggctggcaggaggcagaagagagagctggatcagatggacatc
agaggatccatcgtctacttggaaattgacaacaggcagtgcatccagtcgtcctcccag
tgcttccagagcgcaaccgatgtggcggccttcctgggggccttggcctccctgggcaac
ctcaacattccctacaaaatagaggccgtcaagagtgaaacggcggagcccgcgaggaac
tcccagctgtatcctatgtatgtggtggtggctgcactggtcttgcttgccttcattgga
gtgggagtgctggtgtcccgcaagcggcgcagggagcatggccagctctggttcccagag
ggcttcaaagtgacggagtcgagcaagaagaagcgccgggaaccacttggggaagattct
gttggactgaaacccctcaaaaatgcttctgacggcacgctgatggacgacaaccaaaat
gagtggggtgacgaggagaccctggacaccaagaagttcaggttcgaggagcaggcgatg
ctgcccgacacggatgaccagacggaccacaggcagtggactcagcagcacctggatgct
gccgacctccgcatctcctccatggcccctaccccaccacagggcgagatcgatgcagac
tgcatggatgtcaacgtacgaggtccagacggcttcacgcccctcatgatcgcctcgtgc
agcggaggggggctggagactggcaacagcgaggaggaggacgatgcccctgcagtcatc
tcagatttcatctaccaaggcgccagtttgcacaaccagactgaccgcaccggcgagacc
gcgctgcacctggctgcccgctactcgcgctccgacgctgccaaacgcctgctggaagcc
agtgctgatgcgaacattcaggataacatgggcaggacccctctgcacgccgctgtctct
gctgatgcccaaggagtcttccagatcctgataaggaacagggcgactgatctcgatgcc
cgaatgcacgatgggacgaccccactgatcctggctgctcgcttggctgtggaggggatg
ctggaggacctcatcaactgccacgcagacgtcaacgctgtggatgatctgggcaagtca
gcactgcactgggcagctgctgtgaacaatgtcgaagccgctgtcgtcctcctgaagaac
ggtgccaataaggatatgcagaacaataaggaggagaccccgctgttcctcgccgccaga
gaagggagctacgaaacagccaaggttctgctggaccactttgcgaaccgcgacatcacg
gaccacatggaccggctgccgcgggacatcgcgcaggagcgcatgcaccacgacatcgtg
cggctgctggatgagtacaacctggtgcggagccctccgctgcacagcggccctctcggg
gcccccacgctgtcccccccgctctgctcccccagcagttacatcggcaacctgaagccg
gccgtgcagggcaagaaggccaggaagccgagcaccaagggcctgagctgcaacggcaag
gattccaaagacctgaaagcccggaggaaaaaatcacaagatggaaaaggctgtctgctc
gacaactccagcgtgctgtccccagtggactccctggagtcaccccacgggtacctgtcc
gacgtcgcctcccctccgctgatgacttctccgttccagcagtccccttccatgcctctg
aaccacctgcctggcatgcccgacgcccacatgagcatcaaccacctcaacatggcaggg
aagcaggagatggccctgggcggctctggcaggatggccttcgaggcggtgccgccgcgc
ctctcgcacctccccgtctccagccccagcacggcgatgagcaacgccccgatgaatttc
tccgtcggcggagctgccggcctgagcgggcagtgcgactggctgagccggctgcagagc
ggcatggtgcagaaccagtacggcgccatgcggggcggcatgcagccgggcacgcaccag
caagcacagaacctgcagcacggcatgatgagctccctgcacaacgggctgcccagcacc
agcctgtcgcagatgatgagctaccaggccatgcccagcacccggctggcctcccagccc
cacctgctgcagaaccagcagatgcagcagatgcagcagcccggaatgcagccgcagccc
ggaatgcagccgcagcccggcatgcagcagcctcaacagcagccccagcaacagccccag
ccgcagcagcaccacaaccccggctccaacgccagcggccacatgggccaaaatttcctc
ggtactgagctgagccagcccgacatgcagccggtgagcagcagcgccatggcggtgcac
accatcctgccccaagattcgcagctgctacccacctctctgccgtcctccctcgcgcag
cccatgaccaccacgcagttcctgacccccccttcccagcacagctattcctccccgttg
gacaacacccccagccaccagctccaggtgcccgaccaccccttcctcactccctctccg
gagtctccagaccagtggtcgagctcctcgccccactccaacgtgtccgactggtccgag
ggcatctccagcccccccaccagcatgcagtcgcagatgggacacatccccgaggccttc
aagtga

DBGET integrated database retrieval system