KEGG   Gamma proteobacterium HdN1: HDN1F_35130
Entry
HDN1F_35130       CDS       T01300                                 
Name
(GenBank) conserved hypothetical protein
Organism
gpb  Gamma proteobacterium HdN1
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG FtsK_SpoIIIE AAA_10 DUF87 AAA_22 TrwB_AAD_bind AAA_16 T2SSE AIG1 AAA_7 RNA_helicase
Other DBs
NCBI-ProteinID: CBL47096
UniProt: E1VQK4
Position
4252485..4255340
AA seq 951 aa
MPSANTVKKSAKPAANWLQRLSGQRPWRGRAPLTEKDYAKLWDGPKHAIPDYLPWVDFDD
EKKVFLLNDGVSVGAVFELRQVNVEGKSSEFIGKVQQALKRALAGVPEVYEGNPWIVQIY
LQDEPIESLVQEMQRYAKPAARESQHSKEWFNLLEEHVRQMSREQGIFEDELAGIRWRGL
TRRVRLVLYRYTERGEWLTEDNTLKRSNRSPSRELNQAARVFTRALQGAGVAVKRLEGAA
FFEWMGPFCSPNPVHAKDGYEWVRSVKRYPAPGKRTATYDFGQAVFAEEPRTDEDGRFWF
CDQPTRFLSITPLETTPDVGVITAEIKNASGKEVSLWDELPRGSLFTMTIVIESQLHIKH
HLEDIIQSGGRATREAEMATDQAQHALNYLAEGNRIYRVYPGVYLRGDTDAALEDAMLNT
MTILSQAGLSVIPPKWDLAPIDAFLRALPMAYHYTYDRARLKRAWLCDADDLTALLPLYG
RSTGTGNPGFFFFNRVGEPLLVDPFNKRDRTKTAHLLLFGPTGSGKSATANYLLQHIAAI
HDPRLFIIEKGNSFGRLGKHFAGMGKTVNHIRFTPSLNISLPPYAETSRALEQLEFQEEM
RKSREKMAANGEVDDAISFQVDAEAIDDGEDDEDDQRDFLGEMVNLTILMVTGASKREEE
HLSQADRALLKECLIEGLLASARRGAPHALPQDVVDVMNERLKIPSTDEHQRLRLRDMST
ALGKWTSGIHGHYFNRYGESWPEADCTIVDMGILTGNNNDDMLAVALISLINTITGLGEK
YQHVQGARETIVLIDEGHVITKNPVLAKPLVFGLKTWRKLAIWLWQATQNLADYPDEAEV
MLALAEWWICLTMESEQEIKQIARFKPLTEDERALLVSARKQDGAFTEGVILGSKIKALF
RVVMPALPLVLSMTDVDQKKAIAELARKHGISEIAAAHMMAKKIIQAREQA
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgccgagtgcgaacacggtcaaaaaatccgccaaacccgccgccaattggctgcaacgc
ctgtcagggcaacgtccgtggcgcggtcgtgcgccgttgaccgagaaagactacgccaaa
ctttgggatggccccaaacacgccattcccgattatttgccgtgggtcgattttgacgat
gaaaagaaagtatttttgcttaacgacggcgtaagtgttggcgccgtttttgagttgcgc
caagtgaatgttgaagggaaatcctcggaatttattggcaaagtgcagcaggcgctcaag
cgggcgctggcaggcgtgccggaagtctacgaaggcaacccgtggattgtgcaaatctac
ctgcaagacgaaccgatcgaatcgctggtgcaggagatgcagcgttacgcaaagcctgcg
gcacgggaaagccagcactccaaagaatggttcaacttgttggaggagcatgttcgccag
atgtcacgcgagcaggggatttttgaggacgaactggcggggatccgctggcgcggcctc
acccgacgggtgcgcttggtgctatatcgctacaccgagcgcggcgagtggctgacggaa
gataatacgctgaaacgctccaatcgcagccccagccgtgaactcaatcaagcggcccgc
gtgtttacacgagcgctacagggtgcaggcgtggctgtaaagcgtctggagggcgccgca
ttttttgagtggatggggccgttttgctcacctaaccccgtacacgccaaagatggttat
gagtgggtacgcagtgtaaaacgctatccagcaccgggaaagcgcaccgccacctacgat
tttgggcaagcggtttttgcagaagagccgcgcacggatgaggacggacggttttggttt
tgcgaccagcccacacgctttctgtcgatcaccccactggaaacgacacccgatgttggc
gtgattaccgccgaaattaaaaatgccagcggcaaagaagtctcgttgtgggatgagctg
ccgcgtggctcgctattcacgatgaccatcgtgatcgaatcgcaactgcacattaaacat
cacctcgaagacatcattcagtccggtggtcgtgcgacgcgagaggcggaaatggccacc
gaccaagcccagcatgcgctcaactatttggccgaaggcaaccgaatttaccgagtgtac
cctggcgtttatttacggggtgataccgacgctgcactcgaagatgccatgttaaacacc
atgaccatcctgtcgcaggcgggcctgtcggtcattccgcccaaatgggatttagcaccg
atcgacgcttttttgcgggcgttaccgatggcctatcactacacctacgaccgtgcccgc
ctcaagcgcgcatggctgtgcgatgccgatgacctcactgcactcttgccgttatatggt
cgctctaccggcactggaaaccccggctttttcttctttaaccgtgtgggtgagccgctg
ttggtcgatccttttaataagcgcgaccgcacgaaaaccgctcacttactgctgttcggg
ccaacaggttctggtaaatctgcgacggcaaactacctgctacagcatattgcggccatt
catgacccacgactgttcatcattgagaaaggcaacagttttgggcgtctaggcaagcat
tttgccggcatgggcaaaaccgtgaaccacattcgctttactccctcgctcaacatatcg
ctgccgccttatgcagaaacttcgcgtgcgctggagcaactggaatttcaggaggagatg
cgaaaatcgcgtgaaaaaatggccgccaatggtgaggtggatgatgcgattagctttcag
gtagacgctgaagccatcgacgatggagaagatgatgaggacgatcagcgcgattttctt
ggtgagatggtcaacctcaccattttaatggtcaccggtgccagcaagcgcgaagaagag
catctgtcgcaggcagatcgtgcgctgttaaaagaatgcctcattgaaggactgctggcc
agcgcccgacgcggggcgcctcacgcattgccgcaagacgtggttgatgtgatgaatgag
cgcctgaaaatccccagtaccgatgagcatcaacggctgcgtttacgcgacatgagtacg
gcgctcggcaagtggacgtcgggtattcatggccattacttcaaccgttatggagaaagt
tggccagaggcggattgcaccatcgtggatatggggattcttaccggtaacaacaacgac
gacatgctagccgtcgcgctgatttccctgatcaacacgatcacagggctgggggagaaa
taccagcatgtgcaaggggcacgcgaaaccatcgtgttaatcgacgaaggccacgtgatc
accaaaaaccctgtactcgccaaacccttagtgtttggcctgaaaacatggcggaagctg
gcgatttggttgtggcaagcgacgcaaaacctcgccgactaccccgatgaggccgaggtg
atgctcgcgttggccgagtggtggatctgcctcacgatggaatccgagcaggaaatcaaa
caaattgcgcgattcaaaccactgacagaagacgagcgagccttgctagtcagcgcccga
aaacaggatggcgcatttaccgaaggcgtaattctgggctcaaaaatcaaagcgctgttc
cgtgtcgtgatgcccgccttgccactcgtgctgtccatgaccgacgtcgatcagaagaaa
gcgattgctgagctggcacgtaagcacggcatctctgaaatcgccgccgcccacatgatg
gccaagaaaatcatccaagcacgggagcaagcataa

DBGET integrated database retrieval system