KEGG   Herminiimonas arsenicoxydans: HEAR2020
Entry
HEAR2020          CDS       T00490                                 
Name
(GenBank) Conserved hypothetical protein
Organism
har  Herminiimonas arsenicoxydans
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE TrwB_AAD_bind AAA_10 T2SSE ATPase_2 AAA_7 DUF87 AIG1 AAA_16
Other DBs
NCBI-ProteinID: CAL62164
UniProt: A4G6M7
Position
2026880..2029762
AA seq 960 aa
MRWKLPWHKSAAPKLAASGAGDDERPEGWQRHVEALRQAGIPEPGTAVHGRRPATVADEQ
ALYDVAPSFAEFLPWVEFLPDSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALE
NALQDSFDELDENPWVLQLYAQDEPSFDQYMQTLRDYVQPRARNTAFTEFYLRFFGHHLR
AVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYRRATGQASRRGQTPEQMLNIVCDRLCGGL
ANAGIQARRMVAADVHDWLLRWFNPRPTLLGPGVEDRERFYALARYPDETEDGEIELASG
RDFSQRLFFSQPRSDAEHGTWHFDGMPHRVLVTDRLRMPPGTGHLTGETRKGDAINTLFD
QMPEDTTMCLTMVATPQDILESHLNHLAKKAVGETLASEQTLKDVQEARSLIGSAHKLYR
GTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPSQDR
RNWFTQLMFAQHVANLSPAWGRSQGTGHPGNTFFNRGGGPITFDPLNRLDRQMNAHLFLF
GPTGSGKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSDFAKRLGLTVNRVKLAPGSGI
SLAPFADARRLIETPSDVQTLDADVLDEDMPPDASAMEADEQRDVLGELEITARLMITGG
EDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTRDVRNALRERGQDPTLPEMRRVRL
LEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQLSIAYISLISTVN
NIAERDQYLGRPIINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRA
AEPMLNMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEV
LFRAVPPSLYLALAQTEPEEKAERYQLMQQYGCTELEAAFKVAEKIDQARGIESPALELS
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgcgctggaaactcccctggcacaagtcggccgcgccgaagctggccgcatccggcgca
ggcgatgacgagcggccggagggctggcaacgccacgtcgaggccttgcgccaggccggc
atcccagaacccggcacggcggtccatggccgcaggccggcgaccgtggccgacgagcag
gcgctgtacgacgtcgcgccgtcgttcgcggaattcctgccctgggtggagttcctgccc
gattcgaagtccatgctgctggaagacgggcaatcggtcgcggcattctacgagctggtg
ccgctgggcaccgagggccgggaacccggctggctcgcgcatgcccgcgacgccttggag
aacgcgctccaggactcgttcgatgaactggacgagaacccctgggtactccagctctac
gcccaggacgaacccagcttcgaccagtacatgcagaccctgcgcgactacgtgcagccg
cgcgcccgcaatacggctttcaccgagttctaccttcgcttcttcggacaccacctgcgc
gcggtagcgaagccgggcgggctgttcgaggacacggtggtcacgcggctgcgttggcgc
ggccagacgcggcgcgtgcgcatggtcgtctatcgccgggccaccgggcaggcgagccgc
cgcggccagacgcccgagcagatgctgaacatcgtctgtgatcgcctgtgtggcgggctg
gcgaacgccggcatccaggcccggcgcatggtcgcggccgacgtccatgactggctactg
cggtggtttaacccgcgtcccacgctgctcggccctggggtcgaggaccgcgaacgcttc
tatgcgctggcacgctaccccgacgagacagaagacggtgagatcgagctggcgagcgga
cgggatttcagccagcggcttttcttcagccagccacgttcggacgcggagcacggcacc
tggcacttcgacggcatgccgcatcgtgtgctggtcactgaccggctgcgcatgccgccc
ggcacggggcatttgactggcgaaactcgcaaaggcgatgcgatcaatacgctgttcgat
cagatgcccgaggacacgacgatgtgtctgaccatggtggcgaccccccaggacatcctc
gaatcgcacctgaaccacctggcgaagaaggcagtcggcgaaacactggcatcggaacag
acgctcaaggatgtgcaggaggcccgctcgctgatcggcagcgcgcacaagctgtaccgg
ggaacactggcgttctatttgcgcggccgggatgaagccgaactggaccggcgcggcctt
gatctggcgaacgtgatgcttaacgccggtttgcagcccgtgcgcgaggacgatgaagtc
gcgcctttgaacagttatctgcgctggctgccgtgctgctacaacccgagccaggatcga
cggaactggttcacccaactgatgttcgcccagcacgtggcgaacctctcaccggcctgg
ggccgcagccagggcacgggccatccgggtaatacgttcttcaatcgaggcggcgggccg
atcacctttgacccgctcaaccgcctggatcggcagatgaacgcgcacctgttcctgttc
ggccccaccggctccggcaaaagcgcaacgctcaacaacctcttgaaccaggtcacggcc
atctaccggccgcgcctcttcatcgtggaagccggcaacagcttcggcttgttcagcgat
ttcgccaagcgcctgggcctgactgtgaaccgggtcaagctggcccctggctcgggcatc
agcctggcgccgttcgccgacgcgcgtcggctgatcgaaacgccgagcgacgtgcagacg
ctggatgccgatgtgctggacgaggacatgccacccgatgcatcggccatggaagcggac
gagcagcgcgacgtactcggcgagttggaaatcaccgcacggctgatgatcaccggcggc
gaggataaagaagaggcccggatgacgcgggccgatcgctcgctcatccgccagtgcatc
ctcgacgccgccgagcattgcgtggccgagaagcgcacggtgctcacgcgcgacgtgcgc
aacgcgctgcgcgagcgcggccaggacccaacgctgccagagatgcggcgcgtgcggctg
ctggagatggcagatgccatggacatgttctgtcaaggcaccgatggcgaaatgttcgac
cgcgacggcacgccgtggcccgaggccgacatcaccctggtcgatctggcgacctatgcc
cgcgaaggctacaacgcgcagctttccatcgcctacatcagcctgatcagcacggtgaac
aacatcgccgagcgcgaccagtacctgggccgcccgatcatcaacgtgaccgatgaaggg
cacatcatcaccaagaacccgctgctcgcgccctacgtcgtgaagatcacgaagatgtgg
cgcaagttgggtgcctggttttggctcgcgacgcagaatatcgacgatctgccgcgcgcc
gcggaacccatgctcaacatgatcgagtggtggatctgcctgtcgatgccgccggacgag
gtagagaagatcgcccggttccgcgaactctcgcccgcgcagaaagcgctgatgctttcg
gcgcgcaaagaggcggggaaattcaccgagggcgtcatcctctccaagagcatggaagtg
ctgttccgcgccgtgccgccgagcctgtacctcgcgctcgcgcaaaccgaacccgaagag
aaggcagagcgctaccagctcatgcagcaatacggctgcaccgagctggaagcagctttc
aaggtcgccgagaagatcgaccaggcacgcggcatcgagtcgccggccttggaactgtcg
taa

DBGET integrated database retrieval system