KEGG   Homo sapiens (human): 127829Help
Entry
127829            CDS       T01001                                 

Gene name
ARL8A, ARL10B, GIE2
Definition
(RefSeq) ADP ribosylation factor like GTPase 8A
  KO
K07955  ADP-ribosylation factor-like protein 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    127829 (ARL8A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    127829 (ARL8A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   Arf GTPases
    127829 (ARL8A)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arl8
    127829 (ARL8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Ras Roc Gtr1_RagA SRPRB G-alpha MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 127829
NCBI-ProteinID: NP_620150
OMIM: 616597
HGNC: 25192
Ensembl: ENSG00000143862
Vega: OTTHUMG00000035923
Pharos: Q96BM9(Tbio)
UniProt: Q96BM9 A0A024R977
Structure
PDB: 

Position
1q32.1
AA seq 186 aa AA seqDB search
MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKI
TKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQL
QGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH
SKSRRS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctttgttcaacaagctgctggactggttcaaggccctattctggaaggaggag
atggagctcacgctggtcgggcttcagtactcgggcaagaccaccttcgtcaacgtgatc
gcgtcaggacagttcaacgaggacatgatccccaccgtgggtttcaacatgcgcaaaatc
accaaagggaatgtgactatcaagctctgggacattgggggacagccgcgtttccgcagc
atgtgggagcgctactgccgaggagtgagcgccatcgtgtacatggtggatgctgctgac
caggagaagattgaggcctctaagaacgagctccacaacctactggacaaacctcagctg
cagggcatcccggtcttagtcctgggtaacaagcgagaccttccgggagcattggatgag
aaggagctgattgagaaaatgaatctgtctgccatccaggaccgagagatctgctgctac
tccatctcttgcaaagaaaaggacaacattgacatcaccctacagtggcttattcaacac
tcgaagtcacggagaagctga

DBGET integrated database retrieval system