KEGG   Homo sapiens (human): 133584
Entry
133584            CDS       T01001                                 

Gene name
EGFLAM, AGRINL, AGRNL, PIKA
Definition
(RefSeq) EGF like, fibronectin type III and laminin G domains
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_G_2 fn3 EGF Laminin_G_3 Pur_ac_phosph_N hEGF PTP_tm fn3_4 PGM1_C cEGF
Other DBs
NCBI-GeneID: 133584
NCBI-ProteinID: NP_001192230
OMIM: 617683
HGNC: 26810
Ensembl: ENSG00000164318
Vega: OTTHUMG00000131139
Pharos: Q63HQ2(Tbio)
UniProt: Q63HQ2
Position
5p13.2-p13.1
AA seq 1017 aa
MDLIRGVLLRLLLLASSLGPGAVSLRAAIRKPGKVGPPLDIKLGALNCTAFSIQWKMPRH
PGSPILGYTVFYSEVGADKSLQEQLHSVPLSRDIPTTEEVIGDLKPGTEYRVSIAAYSQA
GKGRLSSPRHVTTLSQDSCLPPAAPQQPHVIVVSDSEVALSWKPGASEGSAPIQYYSVEF
IRPDFDKKWTSIHERIQMDSMVIKGLDPDTNYQFAVRAMNSHGPSPRSWPSDIIRTLCPE
EAGSGRYGPRYITDMGAGEDDEGFEDDLDLDISFEEVKPLPATKGGNKKFLVESKKMSIS
NPKTISRLIPPTSASLPVTTVAPQPIPIQRKGKNGVAIMSRLFDMPCDETLCSADSFCVN
DYTWGGSRCQCTLGKGGESCSEDIVIQYPQFFGHSYVTFEPLKNSYQAFQITLEFRAEAE
DGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDG
LNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGAPSAYWLVRATGTNRGFQGCVQSLAV
NGRRIDMRPWPLGKALSGADVGECSSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRH
CEDAFTLTIPQFRESLRSYAATPWPLEPQHYLSFMEFEITFRPDSGDGVLLYSYDTGSKD
FLSINLAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRVSRTAKNGILQVDKQKIVEGM
AEGGFTQIKCNTDIFIGGVPNYDDVKKNSGVLKPFSGSIQKIILNDRTIHVKHDFTSGVN
VENAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNYCLNTIIEAIEIPQF
IGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGA
LVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNI
NGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHISLVEDAVDGKNINTCGAK
NT seq 3054 nt   +upstreamnt  +downstreamnt
atggatttaatccgaggcgtcttgctccggctcctgctcctggcttccagcctcggaccc
ggcgcggtgtcgctccgagcggccatccgaaaaccaggcaaggtagggcctcctcttgac
atcaagctgggcgcattgaactgtacggctttcagcatccagtggaaaatgccaaggcat
cctggaagtcccatccttgggtacactgtcttttactctgaggttggcgcagataaatcc
ctgcaggagcagttgcacagcgtgcctctcagccgggacatcccgaccacggaggaagtg
attggagatttgaaaccaggcactgaatatcgtgtgagcatagcagcttacagccaggct
ggcaaagggcggctgagctctcctcggcatgtcaccactttgtcccaagattcctgcctg
cctcctgcagctccccagcagccacatgtcattgtggtttcggattctgaggtggccctg
tcttggaaacctggagcgagtgaaggaagcgcccctattcagtactattctgtggaattc
atcaggccagatttcgacaagaagtggacctcaatccatgagcggatccagatggactcc
atggttatcaagggcctcgatccagataccaactaccagtttgccgtgagggcaatgaat
tcccatggccccagcccccgcagctggcccagtgacatcatccggaccctctgccctgag
gaggcgggaagtggccgctatggaccccgttatatcaccgacatgggagctggtgaggat
gatgaaggatttgaagacgacttagatttggatatttcctttgaggaggttaaaccactt
cctgctaccaaaggagggaataagaaatttttggtggaaagcaagaagatgtctatatct
aacccaaagaccatttctaggctcatcccccctacctcagcatctctccctgtgaccacg
gtggctccccagcccattcccatacagagaaaggggaagaatggtgtggccataatgtca
aggctctttgacatgccttgtgatgaaactctctgctctgctgacagcttctgtgtcaat
gactacacctgggggggctcgcgatgccagtgcaccctgggcaaaggtggtgagagctgc
tcagaagatattgttatccagtatcctcagttctttggccactcctatgtaacgtttgaa
cctctgaagaattcttatcaggcatttcaaattactcttgaatttagggcggaggcagag
gatggcttactgctctactgtggggagaacgaacacgggaggggggatttcatgtccctg
gctatcatccgacgctccctgcagttcaggtttaattgtggaactggggttgccatcatc
gtaagtgagaccaaaatcaaactagggggttggcacacggttatgctctacagagatggg
ctgaacgggctgctgcagctgaacaatggcaccccagtgacaggccagtctcagggccaa
tacagtaaaattactttccggacacctctctatcttggtggcgctcccagcgcttactgg
ttggttagagcaacagggacaaaccgaggctttcaaggctgtgtgcagtcgctcgctgtg
aatgggaggagaattgacatgaggccctggcccctgggaaaagcactcagtggggctgat
gtgggggaatgcagcagtggaatctgtgatgaggcctcgtgcatccatggtggcacctgc
acagcaatcaaagccgactcctacatttgcctctgtccccttgggtttaaaggtcgacac
tgtgaagatgctttcaccttgaccattcctcagttcagagagtctctgagatcttacgct
gcaactccctggccactggagccccagcattacctttccttcatggaatttgagatcaca
tttcggccagactcaggagatggtgtcctcctgtacagctatgacacaggcagcaaagac
ttcctgtccatcaacttggcagggggccacgtggagttccgctttgactgtggctctggg
accggtgtcctcaggagtgaagatcccctcaccctgggcaactggcacgagcttcgtgta
tctcgcacagcaaagaatggaatcttacaggtggataagcagaagatagtggagggaatg
gcagagggaggcttcacacagattaagtgcaacacagacattttcattggcggagtcccc
aattatgatgatgtgaagaagaactcgggtgtcctgaagcctttcagcgggagcatccag
aagatcatcctgaatgaccgaaccatccatgtgaagcatgacttcacctccggagtgaat
gtggagaatgcggcccacccctgtgtgagagccccttgtgcccatgggggcagctgccgg
cccaggaaggagggctatgactgtgactgccccttgggctttgaggggcttcactgccag
aaagagtgtgggaactactgcctcaatacgatcatagaagccattgagatcccgcagttt
atcggccgcagttacctgacgtatgacaacccagatatcttgaagagggtgtcaggatca
agatcaaatgtgttcatgaggtttaaaacaactgccaaggatggccttttgctgtggagg
ggagacagccccatgagacccaacagcgacttcatttccttgggccttcgggatggagcc
ctcgtgttcagctataacctgggcagtggtgtggcatccatcatggtgaatggctccttc
aacgatggtcggtggcaccgagttaaggccgttagggatggccagtcaggaaagataacc
gtggatgactatggagccagaacaggcaaatccccaggcatgatgcggcagcttaacatc
aatggagctctgtatgtgggtggaatgaaggaaattgctctgcacactaacaggcaatat
atgagagggctcgtgggctgtatctctcacttcaccctgtccaccgattaccacatttcc
ctcgtggaagatgccgtggatgggaaaaacatcaacacttgtggagccaagtaa

DBGET integrated database retrieval system