KEGG   Homo sapiens (human): 200316
Entry
200316            CDS       T01001                                 

Gene name
APOBEC3F, A3F, ARP8, BK150C2.4.MRNA, KA6
Definition
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic subunit 3F
  KO
K18750  C->U-editing enzyme APOBEC3 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    200316 (APOBEC3F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    200316 (APOBEC3F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     200316 (APOBEC3F)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     200316 (APOBEC3F)
SSDB
Motif
Pfam: NAD2 APOBEC2 NAD1 APOBEC_N SNAD4 APOBEC3 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 AID dCMP_cyt_deam_1 Toxin-deaminase Hairy_orange SGNH
Other DBs
NCBI-GeneID: 200316
NCBI-ProteinID: NP_660341
OMIM: 608993
HGNC: 17356
Ensembl: ENSG00000128394
Vega: OTTHUMG00000151080
Pharos: Q8IUX4(Tbio)
UniProt: Q8IUX4
Structure
PDB: 

Position
22q13.1
AA seq 373 aa
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYS
QPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAA
RLYYYWERDYRRALCRLSQAGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFL
HRTLKEILRNPMEAMYPHIFYFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRN
QVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLT
IFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYN
FLFLDSKLQEILE
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaagcctcacttcagaaacacagtggagcgaatgtatcgagacacattctcctacaac
ttttataatagacccatcctttctcgtcggaataccgtctggctgtgctacgaagtgaaa
acaaagggtccctcaaggccccgtttggacgcaaagatctttcgaggccaggtgtattcc
cagcctgagcaccacgcagaaatgtgcttcctctcttggttctgtggcaaccagctgcct
gcttacaagtgtttccagatcacctggtttgtatcctggaccccctgcccggactgtgtg
gcgaagctggccgaattcctggctgagcaccccaatgtcaccctgaccatctccgccgcc
cgcctctactactactgggaaagagattaccgaagggcgctctgcaggctgagtcaggca
ggggcccgcgtgaagattatggacgatgaagaatttgcatactgctgggaaaactttgtg
tacagtgaaggtcagccattcatgccttggtacaaattcgatgacaattatgcattcctg
caccgcacgctaaaggagattctcagaaacccgatggaggcaatgtatccacacatattc
tacttccactttaaaaacctacgcaaagcctatggtcggaacgaaagctggctgtgcttc
accatggaagttgtaaagcaccactcacctgtctcctggaagaggggcgtcttccgaaac
caggtggatcctgagacccattgtcatgcagaaaggtgcttcctctcttggttctgtgac
gacatactgtctcctaacacaaactacgaggtcacctggtacacatcttggagcccttgc
ccagagtgtgcaggggaggtggccgagttcctggccaggcacagcaacgtgaatctcacc
atcttcaccgcccgcctctactacttctgggatacagattaccaggaggggctccgcagc
ctgagtcaggaaggggcctccgtggagatcatgggctacaaagattttaaatattgttgg
gaaaactttgtgtacaatgatgatgagccattcaagccttggaaaggactaaaatacaac
tttctattcctggacagcaagctgcaggagattctcgagtga

DBGET integrated database retrieval system