KEGG   Homo sapiens (human): 201501Help
Entry
201501            CDS       T01001                                 

Gene name
ZBTB7C, APM-1, APM1, ZBTB36, ZNF857C
Definition
(RefSeq) zinc finger and BTB domain containing 7C
  KO
K10494  zinc finger and BTB domain-containing protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    201501 (ZBTB7C)
   04121 Ubiquitin system [BR:hsa04121]
    201501 (ZBTB7C)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    201501 (ZBTB7C)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     201501 (ZBTB7C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 RXT2_N DUF2457 zf-met TFB6 DUF3268 GAGA zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 201501
NCBI-ProteinID: NP_001034449
OMIM: 616591
HGNC: 31700
Ensembl: ENSG00000184828
Vega: OTTHUMG00000180322
Pharos: A1YPR0(Tdark)
UniProt: A1YPR0 B2RG49
Position
18q21.1
AA seq 619 aa AA seqDB search
MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGTLASQPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIV
NVCLEIMEPGGDGGEEDDKEDDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDP
QDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLLRENLYPKAN
IPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPP
PPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKP
KASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPY
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRG
RKPAAWRAASLLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCLPGPSPAKHFLAAPKG
ALSLQELERQFEETQMKLFGRAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLA
GLPGLAGLNHVASMSEANN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgacattgatgagctcattggcattcccttccccaaccacagcagtgaggtc
ctgtgcagcctcaatgagcaacggcacgatggcctgctgtgtgacgtgctcctggtggtg
caggagcaggagtatcggacccaccgctccgtcctggctgcctgcagcaagtacttcaag
aagcttttcacagccggcaccctagccagccagccctacgtctatgagatcgactttgtc
cagcctgaggctctggctgctatcctggagttcgcctacacctccacgctcaccatcacc
gctggcaatgtcaagcacatcctcaacgcagccaggatgctggagatccagtgcatcgtg
aacgtgtgcctggagatcatggagcctgggggggacgggggggaggaggatgacaaggag
gacgatgacgacgacgaagatgatgatgatgaggaggacgaagaggaggaggaggaagag
gaggaggatgacgatgatgacacggaggactttgctgaccaagaaaacttgcctgacccc
caggacatcagctgccaccaaagcccttccaagacagaccatctcacagagaaggcctat
tcagacacccccagggacttccctgactccttccaggctggcagtcctggccatctgggg
gtgatccgggacttctccatcgaatctctgctaagggagaacctgtaccccaaggccaac
atccccgacaggagaccctccttgtctccattcgccccggacttctttccacacctctgg
ccaggggacttcggtgcctttgcccagctgcctgagcagcccatggacagtgggccactg
gatctggtcatcaagaatcggaagatcaaggaggaggagaaggaggagctgcccccaccc
ccaccgccacccttccctaatgacttcttcaaggacatgttccctgacctgccggggggg
cctctgggacccatcaaggcggagaacgactacggtgcctatctcaacttcctgagtgcc
acccacctgggaggcctcttcccaccctggcccctggtagaagagcgcaagctgaagccc
aaggcctctcagcagtgccccatctgccacaaagtcatcatgggggccgggaagctgccg
cggcacatgaggacccataccggggagaagccatacatgtgcaccatctgcgaggtccgc
ttcaccaggcaggacaagctgaaaatccacatgcggaagcacacaggggagcggccctac
ctgtgcatccactgcaacgccaagttcgtgcacaactacgacctcaagaaccacatgcgc
atccacacgggcgtgcggccctaccagtgcgagttctgctacaagagcttcacgcgctct
gaccacctgcaccgccacatcaagcgccagagctgccgcatggcacggccccgacgcggc
cgcaagcctgctgcgtggagggccgccagcctgctcttcgggcccggcggcccggccccc
gacaaggcggccttcgtgatgccccctgcgctgggcgaggtgggcggccacctgggcggc
gcagctgtgtgcctcccgggccccagccccgccaagcacttcctggcagcgcccaagggc
gccctgagcctgcaagagctggagcggcagttcgaggagacacagatgaagctgttcggg
cgcgcgcagctggaggctgagaggaacgcggggggcctcctggccttcgcgctggccgag
aacgtggcggcggcgcggccctacttcccgctgcccgacccttgggccgccggcctggcc
ggcctccctgggctcgccggcctcaaccacgtggcctccatgtccgaagccaacaactag

DBGET integrated database retrieval system