KEGG   Homo sapiens (human): 285598
Entry
285598            CDS       T01001                                 
Symbol
ARL10, ARL10A
Name
(RefSeq) ADP ribosylation factor like GTPase 10
  KO
K07958  ADP-ribosylation factor-like protein 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    285598 (ARL10)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Others
    285598 (ARL10)
SSDB
Motif
Pfam: Arf G-alpha MMR_HSR1 Roc Ras ABC_tran SRPRB Gtr1_RagA RsgA_GTPase AAA_29 AAA_33 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 285598
NCBI-ProteinID: NP_775935
HGNC: 22042
Ensembl: ENSG00000175414
Pharos: Q8N8L6(Tdark)
UniProt: Q8N8L6 Q6PCE2
Position
5:176365487..176415063
AA seq 244 aa
MAPRPLGPLVLALGGAAAVLGSVLFILWKTYFGRGRERRWDRGEAWWGAEAARLPEWDEW
DPEDEEDEEPALEELEQREVLVLGLDGAGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTK
DFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPV
VVVANKQDLSEAMSMGELQRELGLQAIDNQREVFLLAASIAPAGPTFEEPGTVHIWKLLL
ELLS
NT seq 735 nt   +upstreamnt  +downstreamnt
atggcgccgcggccgctgggccccttggtgctggcgctgggcggcgccgcggcggtgctg
ggctcggtgctcttcatcctctggaagacctacttcggccgcggccgagagcggcgctgg
gaccggggagaggcctggtggggcgcggaggctgcccgcctccccgagtgggacgagtgg
gaccccgaggacgaggaggacgaggagccggcgctggaggagctggaacagcgcgaggtg
ctggtgctggggctggatggcgcaggcaagagcacgttcctgcgcgtgttgtcggggaag
ccaccgctggaaggccacatccccacctggggcttcaactccgtgcgtctgcccaccaag
gactttgaggtggacctgctagaaattgggggcagccagaacctgcgcttctactggaag
gagtttgtgagcgaggtggatgtgctggtgtttgtggtggactcggctgaccgactgcgg
ctgccctgggcccgacaggagctgcacaagctgctggacaaggaccctgacctgcctgtc
gtcgtggtggccaacaagcaggacctgagcgaggccatgagtatgggggagctgcagcgg
gagctgggtctacaggctatcgataaccagcgggaggttttcctcttggcagccagcatt
gcccctgcaggacccacctttgaagagcctggcaccgtgcacatctggaaactgctcttg
gagctcctctcctag

DBGET integrated database retrieval system