KEGG   Homo sapiens (human): 375
Entry
375               CDS       T01001                                 

Gene name
ARF1, PVNH8
Definition
(RefSeq) ADP ribosylation factor 1
  KO
K07937  ADP-ribosylation factor 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05110  Vibrio cholerae infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05134  Legionellosis
Network
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses)
  Element
N00946  Shigella IpaJ to cGAS-STING signaling pathway
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01085  Escherichia EspG to ARNO-ARF-ACTB/G signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    375 (ARF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    375 (ARF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05110 Vibrio cholerae infection
    375 (ARF1)
   05130 Pathogenic Escherichia coli infection
    375 (ARF1)
   05132 Salmonella infection
    375 (ARF1)
   05131 Shigellosis
    375 (ARF1)
   05134 Legionellosis
    375 (ARF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    375 (ARF1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    375 (ARF1)
   04031 GTP-binding proteins [BR:hsa04031]
    375 (ARF1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    375 (ARF1)
  Arf GTPases and associated proteins
   Arf GTPases
    375 (ARF1)
 Endosome - Golgi transport
    375 (ARF1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   375 (ARF1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    375 (ARF1)
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K CRISPR_Cas2
Other DBs
NCBI-GeneID: 375
NCBI-ProteinID: NP_001019397
OMIM: 103180
HGNC: 652
Ensembl: ENSG00000143761
Vega: OTTHUMG00000037595
Pharos: P84077(Tchem)
UniProt: P84077 A0A024R3Q0
Structure
PDB: 

Position
1q42.13
AA seq 181 aa
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
K
NT seq 546 nt   +upstreamnt  +downstreamnt
atggggaacatcttcgccaacctcttcaagggcctttttggcaaaaaagaaatgcgcatc
ctcatggtgggcctggatgctgcagggaagaccacgatcctctacaagcttaagctgggt
gagatcgtgaccaccattcccaccataggcttcaacgtggaaaccgtggagtacaagaac
atcagcttcactgtgtgggacgtgggtggccaggacaagatccggcccctgtggcgccac
tacttccagaacacacaaggcctgatcttcgtggtggacagcaatgacagagagcgtgtg
aacgaggcccgtgaggagctcatgaggatgctggccgaggacgagctccgggatgctgtc
ctcctggtgttcgccaacaagcaggacctccccaacgccatgaatgcggccgagatcaca
gacaagctggggctgcactcactacgccacaggaactggtacattcaggccacctgcgcc
accagcggcgacgggctctatgaaggactggactggctgtccaatcagctccggaaccag
aagtga

DBGET integrated database retrieval system