KEGG   Homo sapiens (human): 378
Entry
378               CDS       T01001                                 

Gene name
ARF4, ARF2
Definition
(RefSeq) ADP ribosylation factor 4
  KO
K07939  ADP-ribosylation factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    378 (ARF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    378 (ARF4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    378 (ARF4)
   04031 GTP-binding proteins [BR:hsa04031]
    378 (ARF4)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    378 (ARF4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   378 (ARF4)
  Exosomal proteins of other body fluids (saliva and urine)
   378 (ARF4)
  Exosomal proteins of colorectal cancer cells
   378 (ARF4)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    378 (ARF4)
SSDB
Motif
Pfam: Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K CRISPR_Cas2 AAA_18
Other DBs
NCBI-GeneID: 378
NCBI-ProteinID: NP_001651
OMIM: 601177
HGNC: 655
Ensembl: ENSG00000168374
Vega: OTTHUMG00000158601
Pharos: P18085(Tbio)
UniProt: P18085
Structure
PDB: 
1Z6X

Position
3p14.3
AA seq 180 aa
MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAV
LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggcctcactatctcctccctcttctcccgactatttggcaagaagcagatgcgcatt
ttgatggttggattggatgctgctggcaagacaaccattctgtataaactgaagttaggg
gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac
atttgtttcacagtatgggatgttggtggtcaagatagaattaggcctctctggaagcat
tacttccagaatacccagggtcttatttttgtggtagatagcaacgatcgtgaaagaatt
caggaagtagcagatgagctgcagaaaatgcttctggtagatgaattgagagatgcagtg
ctgctactttttgcaaacaaacaggatttgccaaatgctatggccatcagtgaaatgaca
gataaactagggcttcagtctcttcgtaacagaacatggtatgttcaagccacttgtgca
acacaaggaactggtctgtatgaaggacttgactggctgtcaaatgagctttcaaaacgt
taa

DBGET integrated database retrieval system