KEGG   Homo sapiens (human): 381Help
Entry
381               CDS       T01001                                 

Gene name
ARF5
Definition
(RefSeq) ADP ribosylation factor 5
  KO
K07940  ADP-ribosylation factor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    381 (ARF5)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    381 (ARF5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   381 (ARF5)
  Exosomal proteins of colorectal cancer cells
   381 (ARF5)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    381 (ARF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K CbiA
Motif
Other DBs
NCBI-GeneID: 381
NCBI-ProteinID: NP_001653
OMIM: 103188
HGNC: 658
Ensembl: ENSG00000004059
Vega: OTTHUMG00000023246
Pharos: P84085(Tbio)
UniProt: P84085 A4D0Z3
Structure
PDB: 

Position
7q32.1
AA seq 180 aa AA seqDB search
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV
LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaccgtgtccgcgctcttttcgcggatcttcgggaagaagcagatgcggatt
ctcatggttggcttggatgcggctggcaagaccacaatcctgtacaaactgaagttgggg
gagattgtcaccaccatcccaaccataggcttcaatgtagaaacagtggaatataagaac
atctgtttcacagtctgggacgtgggaggccaggacaagattcggcctctgtggcggcac
tacttccagaacactcagggcctcatctttgtggtggacagtaatgaccgggagcgggtc
caagaatctgctgatgaactccagaagatgctgcaggaggacgagctgcgggatgcagtg
ctgctggtatttgccaacaagcaggacatgcccaacgccatgcccgtgagcgagctgact
gacaagctggggctacagcacttacgcagccgcacgtggtatgtccaggccacctgtgcc
acccaaggcacaggtctgtacgatggtctggactggctgtcccacgagctgtcaaagcgc
taa

DBGET integrated database retrieval system