Entry |
|
Symbol |
RHOA, ARH12, ARHA, EDFAOB, RHO12, RHOH12
|
Name |
(RefSeq) ras homolog family member A
|
KO |
K04513 | Ras homolog gene family, member A |
|
Organism |
|
Pathway |
hsa04072 | Phospholipase D signaling pathway |
hsa04270 | Vascular smooth muscle contraction |
hsa04621 | NOD-like receptor signaling pathway |
hsa04625 | C-type lectin receptor signaling pathway |
hsa04660 | T cell receptor signaling pathway |
hsa04670 | Leukocyte transendothelial migration |
hsa04810 | Regulation of actin cytoskeleton |
hsa04928 | Parathyroid hormone synthesis, secretion and action |
hsa05100 | Bacterial invasion of epithelial cells |
hsa05130 | Pathogenic Escherichia coli infection |
hsa05163 | Human cytomegalovirus infection |
hsa05418 | Fluid shear stress and atherosclerosis |
|
Network |
|
Element |
N00393 | ITGA/B-RhoGAP-RhoA signaling pathway |
N00394 | HCMV gH to ITGA/B-RhoA signaling pathway |
N00405 | CXCR4-GNA12/13-Rho signaling pathway |
N00408 | LPAR-GNB/G-Rho signaling pathway |
N01072 | ITGA/B-RhoGEF-RhoA signaling pathway |
N01073 | Shigella IpgB2 to ITGA/B-RhoGEF-RhoA signaling pathway |
N01074 | Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway |
N01075 | Shigella IcsB to ITGA/B-RhoGEF-RhoA signaling pathway |
N01089 | Escherichia EspM to LPA-GNA12/13-Rho signaling pathway |
N01095 | Escherichia Map to LPA-GNA12/13-RhoA signaling pathway |
N01097 | LPA-GNA12/13-RhoA signaling pathway |
N01098 | Yersinia YopT to ITGA/B-RhoGEF-RhoA signaling pathway |
N01099 | Yersinia YopE to RhoA signaling pathway |
N01104 | LPA-GNAQ/11-RhoA signaling pathway |
N01130 | Salmonella SopB to RhoA signaling pathway |
N01131 | Salmonella SopE/E2 to RhoA signaling pathway |
N01285 | Microtubule-RHOA signaling pathway |
|
Disease |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
387 (RHOA)
04015 Rap1 signaling pathway
387 (RHOA)
04310 Wnt signaling pathway
387 (RHOA)
04350 TGF-beta signaling pathway
387 (RHOA)
04072 Phospholipase D signaling pathway
387 (RHOA)
04071 Sphingolipid signaling pathway
387 (RHOA)
04024 cAMP signaling pathway
387 (RHOA)
04022 cGMP-PKG signaling pathway
387 (RHOA)
04150 mTOR signaling pathway
387 (RHOA)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
387 (RHOA)
09144 Cellular community - eukaryotes
04510 Focal adhesion
387 (RHOA)
04520 Adherens junction
387 (RHOA)
04530 Tight junction
387 (RHOA)
09142 Cell motility
04810 Regulation of actin cytoskeleton
387 (RHOA)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
387 (RHOA)
04621 NOD-like receptor signaling pathway
387 (RHOA)
04625 C-type lectin receptor signaling pathway
387 (RHOA)
04660 T cell receptor signaling pathway
387 (RHOA)
04670 Leukocyte transendothelial migration
387 (RHOA)
04062 Chemokine signaling pathway
387 (RHOA)
09152 Endocrine system
04921 Oxytocin signaling pathway
387 (RHOA)
04928 Parathyroid hormone synthesis, secretion and action
387 (RHOA)
09153 Circulatory system
04270 Vascular smooth muscle contraction
387 (RHOA)
09154 Digestive system
04972 Pancreatic secretion
387 (RHOA)
09156 Nervous system
04722 Neurotrophin signaling pathway
387 (RHOA)
09158 Development and regeneration
04360 Axon guidance
387 (RHOA)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
387 (RHOA)
05206 MicroRNAs in cancer
387 (RHOA)
05205 Proteoglycans in cancer
387 (RHOA)
05203 Viral carcinogenesis
387 (RHOA)
09162 Cancer: specific types
05210 Colorectal cancer
387 (RHOA)
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
387 (RHOA)
09171 Infectious disease: bacterial
05130 Pathogenic Escherichia coli infection
387 (RHOA)
05132 Salmonella infection
387 (RHOA)
05131 Shigellosis
387 (RHOA)
05135 Yersinia infection
387 (RHOA)
05133 Pertussis
387 (RHOA)
05152 Tuberculosis
387 (RHOA)
05100 Bacterial invasion of epithelial cells
387 (RHOA)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
387 (RHOA)
05418 Fluid shear stress and atherosclerosis
387 (RHOA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:hsa04131]
387 (RHOA)
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:hsa04147]
387 (RHOA)
04031 GTP-binding proteins [BR:hsa04031]
387 (RHOA)
Membrane trafficking [BR:hsa04131]
Endocytosis
Lipid raft mediated endocytosis
RhoA-dependent endocytosis
387 (RHOA)
Exosome [BR:hsa04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
387 (RHOA)
Exosomal proteins of other body fluids (saliva and urine)
387 (RHOA)
Exosomal proteins of colorectal cancer cells
387 (RHOA)
Exosomal proteins of bladder cancer cells
387 (RHOA)
GTP-binding proteins [BR:hsa04031]
Small (monomeric) G-proteins
Rho Family
RhoA/B/C [OT]
387 (RHOA)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
3:complement(49359145..49411976)
|
AA seq |
193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL |
NT seq |
582 nt +upstreamnt +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggaaagacatgc
ttgctcatagtcttcagcaaggaccagttcccagaggtgtatgtgcccacagtgtttgag
aactatgtggcagatatcgaggtggatggaaagcaggtagagttggctttgtgggacaca
gctgggcaggaagattatgatcgcctgaggcccctctcctacccagataccgatgttata
ctgatgtgtttttccatcgacagccctgatagtttagaaaacatcccagaaaagtggacc
ccagaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaa
gctagacgtgggaagaaaaaatctgggtgccttgtcttgtga |