KEGG   Homo sapiens (human): 391
Entry
391               CDS       T01001                                 

Gene name
RHOG, ARHG
Definition
(RefSeq) ras homolog family member G
  KO
K07863  Ras homolog gene family, member G
Organism
hsa  Homo sapiens (human)
Pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N00951  ITGA/B-RHOG-RAC signaling pathway
N01100  Yersinia YopE to ITGA/B-RHOG-RAC signaling pathway
N01101  Yersinia YopT to ITGA/B-RHOG-RAC signaling pathway
N01132  Salmonella SopE/E2 to RhoG signaling pathway
N01133  Salmonella SopB to RhoG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    391 (RHOG)
   05135 Yersinia infection
    391 (RHOG)
   05100 Bacterial invasion of epithelial cells
    391 (RHOG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    391 (RHOG)
   04031 GTP-binding proteins [BR:hsa04031]
    391 (RHOG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   391 (RHOG)
  Exosomal proteins of other body fluids (saliva and urine)
   391 (RHOG)
  Exosomal proteins of colorectal cancer cells
   391 (RHOG)
  Exosomal proteins of bladder cancer cells
   391 (RHOG)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    391 (RHOG)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA
Other DBs
NCBI-GeneID: 391
NCBI-ProteinID: NP_001656
OMIM: 179505
HGNC: 672
Ensembl: ENSG00000177105
Vega: OTTHUMG00000012287
Pharos: P84095(Tbio)
UniProt: P84095 Q6ICQ8
Position
11p15.4
AA seq 191 aa
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCILL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagagcatcaagtgcgtggtggtgggtgatggggctgtgggcaagacgtgcctgctc
atctgctacacaactaacgctttccccaaagagtacatccccaccgtgttcgacaattac
agcgcgcagagcgcagttgacgggcgcacagtgaacctgaacctgtgggacactgcgggc
caggaggagtatgaccgcctccgtacactctcctaccctcagaccaacgttttcgtcatc
tgtttctccattgccagtccgccgtcctatgagaacgtgcggcacaagtggcatccagag
gtgtgccaccactgccctgatgtgcccatcctgctggtgggcaccaagaaggacctgaga
gcccagcctgacaccctacggcgcctcaaggagcagggccaggcgcccatcacaccgcag
cagggccaggcactggccaagcagatccacgctgtgcgctacctcgaatgctcagccctg
caacaggatggtgtcaaggaagtgttcgccgaggctgtccgggctgtgctcaaccccacg
ccgatcaagcgtgggcggtcctgcatcctcttgtga

DBGET integrated database retrieval system