KEGG   Homo sapiens (human): 400Help
Entry
400               CDS       T01001                                 

Gene name
ARL1, ARFL1
Definition
(RefSeq) ADP ribosylation factor like GTPase 1
  KO
K07942  ADP-ribosylation factor-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    400 (ARL1)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    400 (ARL1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPases
    400 (ARL1)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arl1/Arl5 [OT]
    400 (ARL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc Ras G-alpha SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU MeaB ABC_tran FeoB_N AAA_18
Motif
Other DBs
NCBI-GeneID: 400
NCBI-ProteinID: NP_001168
OMIM: 603425
HGNC: 692
Ensembl: ENSG00000120805
Vega: OTTHUMG00000170271
Pharos: P40616(Tbio)
UniProt: P40616
Structure
PDB: 

Position
12q23.2
AA seq 181 aa AA seqDB search
MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKN
LKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAI
LVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSR
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtggctttttctcaagtatattttccagtctgtttggaactcgggaaatgagaatt
ttaattttgggattagatggagcaggaaaaaccacaattttgtacagattacaagtggga
gaagttgttactactatacctaccattggatttaatgtagagacggtgacgtacaaaaac
cttaaattccaagtctgggatttaggaggacagacaagtatcaggccatactggagatgt
tactattcaaacacagatgcagtcatttatgtagtagacagttgtgaccgagaccgaatt
ggcatttccaaatcagagttagttgccatgttggaggaagaagagctgagaaaagccatt
ttagtggtgtttgcaaataaacaggacatggaacaggccatgacttcctcagagatggca
aattcacttgggttacctgccttgaaggaccgaaaatggcagatattcaaaacgtcagca
accaaaggcaccggccttgatgaggcaatggaatggttagttgaaacattaaaaagcaga
cagtaa

DBGET integrated database retrieval system