KEGG   Homo sapiens (human): 4052
Entry
4052              CDS       T01001                                 

Symbol
LTBP1, ARCL2E
Name
(RefSeq) latent transforming growth factor beta binding protein 1
  KO
K19559  latent transforming growth factor beta binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4052 (LTBP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    4052 (LTBP1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EGF-like domain-containing proteins
  hEGF / cEGF domain-containing proteins
   4052 (LTBP1)
SSDB
Motif
Pfam: EGF_CA cEGF TB EGF EGF_3 hEGF Plasmod_Pvs28 FXa_inhibition EGF_MSP1_1
Other DBs
NCBI-GeneID: 4052
NCBI-ProteinID: NP_996826
OMIM: 150390
HGNC: 6714
Ensembl: ENSG00000049323
Vega: OTTHUMG00000152118
Pharos: Q14766(Tbio)
UniProt: Q14766
Structure
PDB: 
1KSQ

Position
2p22.3
AA seq 1721 aa
MAGAWLRWGLLLWAGLLASSAHGRLRRITYVVHPGPGLAAGALPLSGPPRSRTFNVALNA
RYSRSSAAAGAPSRASPGVPSERTRRTSKPGGAALQGLRPPPPPPPEPARPAVPGGQLHP
NPGGHPAAAPFTKQGRQVVRSKVPQETQSGGGSRLQVHQKQQLQGVNVCGGRCCHGWSKA
PGSQRCTKPSCVPPCQNGGMCLRPQLCVCKPGTKGKACETIAAQDTSSPVFGGQSPGAAS
SWGPPEQAAKHTSSKKADTLPRVSPVAQMTLTLKPKPSVGLPQQIHSQVTPLSSQSVVIH
HGQTQEYVLKPKYFPAQKGISGEQSTEGSFPLRYVQDQVAAPFQLSNHTGRIKVVFTPSI
CKVTCTKGSCQNSCEKGNTTTLISENGHAADTLTATNFRVVICHLPCMNGGQCSSRDKCQ
CPPNFTGKLCQIPVHGASVPKLYQHSQQPGKALGTHVIHSTHTLPLTVTSQQGVKVKFPP
NIVNIHVKHPPEASVQIHQVSRIDGPTGQKTKEAQPGQSQVSYQGLPVQKTQTIHSTYSH
QQVIPHVYPVAAKTQLGRCFQETIGSQCGKALPGLSKQEDCCGTVGTSWGFNKCQKCPKK
PSYHGYNQMMECLPGYKRVNNTFCQDINECQLQGVCPNGECLNTMGSYRCTCKIGFGPDP
TFSSCVPDPPVISEEKGPCYRLVSSGRQCMHPLSVHLTKQLCCCSVGKAWGPHCEKCPLP
GTAAFKEICPGGMGYTVSGVHRRRPIHHHVGKGPVFVKPKNTQPVAKSTHPPPLPAKEEP
VEALTFSREHGPGVAEPEVATAPPEKEIPSLDQEKTKLEPGQPQLSPGISTIHLHPQFPV
VIEKTSPPVPVEVAPEASTSSASQVIAPTQVTEINECTVNPDICGAGHCINLPVRYTCIC
YEGYRFSEQQRKCVDIDECTQVQHLCSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDE
CLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSY
QCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDI
DECQQGNLCVNGQCKNTEGSFRCTCGQGYQLSAAKDQCEDIDECQHRHLCAHGQCRNTEG
SFQCVCDQGYRASGLGDHCEDINECLEDKSVCQRGDCINTAGSYDCTCPDGFQLDDNKTC
QDINECEHPGLCGPQGECLNTEGSFHCVCQQGFSISADGRTCEDIDECVNNTVCDSHGFC
DNTAGSFRCLCYQGFQAPQDGQGCVDVNECELLSGVCGEAFCENVEGSFLCVCADENQEY
SPMTGQCRSRTSTDLDVDVDQPKEEKKECYYNLNDASLCDNVLAPNVTKQECCCTSGVGW
GDNCEIFPCPVLGTAEFTEMCPKGKGFVPAGESSSEAGGENYKDADECLLFGQEICKNGF
CLNTRPGYECYCKQGTYYDPVKLQCFDMDECQDPSSCIDGQCVNTEGSYNCFCTHPMVLD
ASEKRCIRPAESNEQIEETDVYQDLCWEHLSDEYVCSRPLVGKQTTYTECCCLYGEAWGM
QCALCPLKDSDDYAQLCNIPVTGRRQPYGRDALVDFSEQYTPEADPYFIQDRFLNSFEEL
QAEECGILNGCENGRCVRVQEGYTCDCFDGYHLDTAKMTCVDVNECDELNNRMSLCKNAK
CINTDGSYKCLCLPGYVPSDKPNYCTPLNTALNLEKDSDLE
NT seq 5166 nt   +upstreamnt  +downstreamnt
atggcgggggcctggctcaggtgggggctcctgctctgggcagggctcctcgcgtcctcg
gcgcacggccggctgcggaggatcacctacgtggtgcacccgggccccggcctggcagcc
ggcgccttgcccctgagcgggcccccgcgttcgcggacattcaacgtcgcgctcaacgcc
aggtacagccgcagctcggcggctgccggcgcccccagccgtgcctcccccggggtcccc
tcggagaggacccggcgcacgagcaagccgggcggcgcggccctgcaggggctcagaccg
ccgccgccgccgccgccggagcctgcgcgtcccgcggtccccggcgggcagctccacccc
aatcccggcggccacccggcagccgccccgttcaccaaacaaggcaggcaagttgtgcgc
tccaaggtgccgcaggagacccagagcggcggaggctctaggctgcaggttcaccagaag
cagcagctgcagggggtcaatgtctgtggagggcggtgctgtcatggctggagtaaggcc
cctggctcccagaggtgcaccaaacctagctgtgttccgccatgtcagaatggagggatg
tgtctccggccacaactctgtgtgtgtaaaccagggaccaagggcaaagcctgtgaaaca
atagctgcccaggacacctcgtcaccagtctttggagggcagagtcctggggctgcttcc
tcgtggggccctcctgagcaagcagcaaagcatacttcatctaagaaggcagacactcta
ccaagagtcagccctgtggcccagatgaccttaaccctcaagccgaagccttcagtggga
ctcccccagcagatacattctcaagtgactcctctttcttcccagagtgtggtgattcac
catggccagacccaggaatacgtgctcaagcccaagtactttccagcccagaaggggatt
tcaggagagcagtccactgaaggttctttccctttaagatatgtgcaggatcaagttgcg
gcaccttttcagctgagtaaccacactggccgcatcaaggtggtctttactccgagcatc
tgtaaagtgacctgcaccaagggcagctgtcagaacagctgtgagaaggggaacaccacc
actctcattagtgagaatggtcatgctgccgacaccctgacggccacgaacttccgagtg
gtaatttgccatcttccatgtatgaatggtggccagtgcagttcaagggacaaatgtcag
tgccctccaaatttcacaggaaaactttgtcagatcccagtccatggtgccagcgtgcct
aaactttatcagcattcccagcagccaggcaaggcgttggggacgcatgtcatccattca
acacataccttgcctctgaccgtgactagccagcaaggagtcaaagtgaaatttcctcct
aacatagtcaatatccatgtgaaacatcctcctgaagcttccgtccagatacatcaggtt
tcaagaattgatggcccaacaggccagaagacaaaagaagctcaaccaggccaatcccaa
gtctcgtaccaagggcttcctgtccagaagacccagaccatacattccacatactcccac
cagcaggtcattcctcacgtctaccccgtggctgctaagacacagcttggccggtgcttc
caggaaaccattgggtcacagtgtggcaaagcgctccctggcctttcaaagcaagaggac
tgctgtggaactgtgggtacctcctggggctttaacaaatgccagaaatgccccaagaaa
ccatcttatcatggatacaaccaaatgatggaatgcctaccgggttataagcgggttaac
aacaccttttgccaagatattaatgaatgtcagctacaaggtgtatgccctaatggtgag
tgtttgaataccatgggcagctatcgatgtacctgcaaaataggatttgggccggatcct
accttttcaagttgtgttcctgatccccctgtgatctcggaagagaaagggccctgttac
cgacttgtcagttctggaagacagtgtatgcaccctctgtctgttcacctcaccaagcag
ctctgctgttgtagtgtgggcaaggcctggggcccacactgtgagaaatgtccccttcca
ggcacagctgcttttaaggaaatctgtcctggtggaatgggttatacggtttctggcgtt
catagacgcaggccaatccatcaccatgtaggtaaaggacctgtatttgtcaagccaaag
aacactcaacctgttgctaaaagtactcatcctccacctctcccagccaaggaagagcca
gtggaggccctgaccttctcccgggaacacgggccaggagtggcggagccagaagtggca
actgcaccccctgaaaaggaaataccttcattggatcaagagaaaaccaaacttgagcct
ggtcaaccccagctgtctccaggcatttccactattcatctgcatccacagtttccagta
gtgattgaaaaaacatcacctcctgtgcctgttgaagtagctcctgaagcttctacgtct
agtgccagccaagtgattgctcctactcaagtgacagaaatcaatgaatgtactgtgaac
cctgatatctgtggagcaggacactgcattaacctaccagtgagatatacctgtatatgc
tacgagggctacaggttcagtgaacaacagaggaaatgtgtggatattgatgagtgtact
caggtccaacacctctgctcccagggccgctgtgaaaacaccgagggaagtttcttgtgc
atttgcccagcaggatttatggccagtgaggagggtactaactgcatagatgttgacgaa
tgcctgaggccggacgtctgtggggaggggcactgtgtcaatactgtgggggccttccgg
tgtgaatactgtgacagcgggtaccgcatgactcagagaggccgttgtgaggatattgat
gaatgtttgaatccaagcacttgtccagatgagcagtgtgtgaattctcctggatcttac
cagtgcgttccctgcacagaaggattccgaggctggaatggacagtgccttgatgtggac
gagtgcctggaaccaaacgtctgcgcaaatggtgattgttccaaccttgaaggctcctac
atgtgttcatgccacaaaggctatacccggactccggaccacaagcactgtagagatatt
gatgaatgtcagcaagggaatctatgtgtaaacgggcagtgcaaaaataccgagggctcc
ttcaggtgcacctgtggacaggggtaccagctgtcggcagctaaagaccagtgtgaagac
attgatgaatgccagcaccgtcatctctgtgctcatgggcagtgcaggaacactgagggc
tcttttcaatgtgtgtgtgaccagggttacagagcatctgggcttggagaccactgtgaa
gatatcaatgaatgcttggaggacaagagtgtttgccagagaggagactgcattaatact
gcagggtcctatgattgtacttgtccggatggatttcagctagatgacaataaaacatgt
caagatattaatgaatgtgaacatccagggctctgtggtccgcaaggggagtgcctaaac
acagagggttctttccattgtgtctgccagcagggtttctcaatctctgcagatggccgt
acgtgtgaagatattgatgaatgtgtaaacaacactgtttgtgacagtcacgggttttgt
gacaatacagctggctccttccgctgcctctgttatcagggctttcaagccccacaggat
gggcaagggtgtgtggatgtgaatgaatgtgaactgctcagtggggtgtgtggtgaagcc
ttctgtgaaaacgtggaagggtccttcctgtgcgtgtgtgctgatgaaaaccaagagtac
agccccatgactgggcagtgccgctcccggacctccacagatttagatgtagatgtagat
caacccaaagaagaaaagaaagaatgctactataatctcaatgacgccagtctctgtgat
aatgtgttggcccccaatgtcacgaaacaagaatgctgctgtacatcaggcgtgggatgg
ggagataactgcgaaatcttcccctgcccggtcttgggaactgctgagttcactgaaatg
tgtcccaaagggaaaggttttgtgcctgctggagaatcatcttctgaagctggtggtgag
aactataaagatgcagatgaatgcctactttttggacaagaaatctgcaaaaatggtttc
tgtttgaacactcggcctgggtatgaatgctactgtaagcaagggacgtactatgatcct
gtgaaactgcagtgctttgatatggatgaatgtcaagaccccagtagttgtattgatggc
cagtgtgttaatacagagggctcttacaactgcttctgtactcaccccatggtcctggat
gcgtcagaaaaaagatgtatacgaccggctgagtcaaacgaacaaatagaagaaactgat
gtctaccaagatttgtgctgggaacatctgagtgatgaatacgtgtgtagccggcctctt
gtgggcaagcagacaacgtacactgagtgctgctgtctgtatggagaggcctggggcatg
cagtgtgccctctgccccctgaaggattcagatgactatgctcagctgtgtaacatcccc
gtgacgggacgccggcagccatatggacgggacgccttggttgacttcagtgaacagtat
actccagaagccgatccctacttcatccaagaccgttttctaaatagctttgaggagtta
caggctgaggaatgcggcatcctcaatggatgtgaaaatggtcgctgtgtgagggtccag
gaaggttacacctgcgattgctttgatgggtatcacttggatacggccaagatgacctgt
gtcgatgtaaatgaatgcgatgagttgaacaaccggatgtctctctgcaagaatgccaag
tgcattaacaccgatggttcctacaagtgtttgtgtctgccaggctacgtgccttctgac
aagccaaactactgcactccgttgaataccgccttgaatttagagaaagacagtgacctg
gagtga

DBGET integrated database retrieval system