KEGG   Homo sapiens (human): 4685
Entry
4685              CDS       T01001                                 
Symbol
NCAM2, NCAM21
Name
(RefSeq) neural cell adhesion molecule 2
  KO
K06491  neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa03265  Virion - Ebolavirus, Lyssavirus and Morbillivirus
hsa04514  Cell adhesion molecules
hsa05020  Prion disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus
    4685 (NCAM2)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    4685 (NCAM2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    4685 (NCAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4685 (NCAM2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    4685 (NCAM2)
   04090 CD molecules [BR:hsa04090]
    4685 (NCAM2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    4685 (NCAM2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    4685 (NCAM2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4685 (NCAM2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  NCAM1/2
   4685 (NCAM2)
CD molecules [BR:hsa04090]
 Proteins
  4685 (NCAM2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   4685 (NCAM2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  4685 (NCAM2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_C17orf99 Ig_6 Ig_4 Pur_ac_phosph_N Izumo-Ig Adeno_E3_CR1 V-set_CD47
Other DBs
NCBI-GeneID: 4685
NCBI-ProteinID: NP_004531
OMIM: 602040
HGNC: 7657
Ensembl: ENSG00000154654
UniProt: O15394
Position
21:20998409..21543329
AA seq 837 aa
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEP
AISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFV
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQH
GSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNH
IGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASE
IWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERVT
NHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctggggttgcttgtcagtagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgttggagaatctaaattcttc
acatgtacagcgattggtgaacctgaaagtatagattggtataatcctcaaggagagaag
ataatttcaacacagagggtagtagtgcaaaaggaaggtgttaggtcacggttaaccatc
tacaatgcaaatatagaagatgcagggatatatcgttgtcaagcaacagatgccaaagga
caaacacaagaagctacagtagttttggaaatttaccaaaaactcactttcagagaagtg
gtatctccacaagaattcaaacaaggagaagatgcagaagtggtttgccgagttagcagt
tcacctgcacctgctgtcagctggttgtatcataatgaggaagtcaccactatttccgac
aatcggttcgctatgttagcaaacaataacctgcagattctcaacatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggccaggggagaaattgacttccgtgat
atcattgttattgttaatgtgccgccagcaatctcaatgcctcagaaatcttttaatgcc
acagcagagagaggagaagaaatgacattttcctgcagggcctcaggctctccagaaccc
gccatctcctggttcaggaatggcaagctcattgaagaaaatgagaagtacatattgaaa
gggagcaatacagaactcactgtcaggaacataatcaatagtgatggtggtccttatgtc
tgcagggccacaaataaggcaggagaagatgaaaagcaagctttcctccaagtctttgta
cagcctcacataatacagcttaaaaatgaaactacatatgagaatggtcaagtcacactc
gtatgtgatgcggaaggggagcctattccagaaatcacttggaaaagagctgtggatggc
ttcacgttcactgaaggcgataagagcctggacggccgtatcgaagtcaaagggcagcat
ggaagctcatcactgcatattaaagatgtgaagttgtcagattcagggagatatgactgt
gaagctgcaagcagaattggagggcatcaaaagagcatgtaccttgatattgaatatgcc
cccaagtttatatcaaaccaaacaatttattactcttgggaaggaaatcctatcaatata
agttgtgatgtgaaatcgaatccaccagcatcaattcactggagaagagataaattagtc
ttacctgctaaaaacacgaccaatttaaagacttatagtacaggaagaaagatgatatta
gagattgcacctacatctgacaatgactttggacgctataattgcacagccactaatcat
ataggaacaagatttcaagaatatattcttgctttggctgacgtgccatccagtccctat
ggagtgaagatcatagagctgtcgcagaccacggccaaggtttccttcaacaaaccggac
tcccatggaggtgtacctattcatcactatcaggtggatgtcaaagaagtagcgtcagaa
atctggaaaattgtacgctcccatggagttcaaacaatggttgttttgaacaacctggaa
ccaaatacaacttatgaaatcagggttgcagctgtaaatggaaagggacaaggagactac
agtaaaatagaaatcttccaaacattaccagttcgtgaaccaagtcctccatccatacat
ggacagccaagcagtggaaagagctttaaactcagcatcaccaaacaggacgatggaggg
gcccctattttggaatacattgtgaaatatagaagtaaagataaggaagaccaatggcta
gagaaaaaagtgcaaggaaataaagaccacatcattttggagcatctccagtggaccatg
gggtatgaagttcagattacagctgccaatagattgggatattctgaaccgacagtttat
gaattcagcatgccaccaaagcccaacattattaaagacacgctgtttaatggtcttggg
cttggagcagtaattggcctgggagttgctgcactgctgctaattcttgtggtaacagac
gtcagctgcttctttattcggcaatgtgggttgctgatgtgcatcactaggagaatgtgt
ggaaagaaaagtggctccagtggcaaaagtaaagaactcgaagaaggaaaagctgcatac
ctgaaagatggatcaaaagaaccaatagtggagatgagaacagaggatgaaagagttact
aatcacgaagatgggagcccagtaaatgagccaaatgaaaccacaccactgacagaacct
gaaaaattgcctttaaaggaagaagatgggaaagaagctctaaatccagaaactatagaa
attaaagtttctaacgacatcattcaatcaaaagaagacgacagcaaagcataa

DBGET integrated database retrieval system