KEGG   Homo sapiens (human): 4685Help
Entry
4685              CDS       T01001                                 

Gene name
NCAM2, NCAM21
Definition
(RefSeq) neural cell adhesion molecule 2
  KO
K06491  neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4685 (NCAM2)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    4685 (NCAM2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4685 (NCAM2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  NCAM1/2
   4685 (NCAM2)
CD molecules [BR:hsa04090]
 Proteins
  4685 (NCAM2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface
   4685 (NCAM2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  4685 (NCAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Izumo-Ig Ig_5 Ig_4 Adeno_E3_CR1 Pur_ac_phosph_N Herpes_gE PKD_3
Motif
Other DBs
NCBI-GeneID: 4685
NCBI-ProteinID: NP_004531
OMIM: 602040
HGNC: 7657
Ensembl: ENSG00000154654
Vega: OTTHUMG00000078121
Pharos: O15394(Tbio)
UniProt: O15394
Structure
PDB: 

Position
21q21.1
AA seq 837 aa AA seqDB search
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEP
AISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFV
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQH
GSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNH
IGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASE
IWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERVT
NHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctggggttgcttgtcagtagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgttggagaatctaaattcttc
acatgtacagcgattggtgaacctgaaagtatagattggtataatcctcaaggagagaag
ataatttcaacacagagggtagtagtgcaaaaggaaggtgttaggtcacggttaaccatc
tacaatgcaaatatagaagatgcagggatatatcgttgtcaagcaacagatgccaaagga
caaacacaagaagctacagtagttttggaaatttaccaaaaactcactttcagagaagtg
gtatctccacaagaattcaaacaaggagaagatgcagaagtggtttgccgagttagcagt
tcacctgcacctgctgtcagctggttgtatcataatgaggaagtcaccactatttccgac
aatcggttcgctatgttagcaaacaataacctgcagattctcaacatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggccaggggagaaattgacttccgtgat
atcattgttattgttaatgtgccgccagcaatctcaatgcctcagaaatcttttaatgcc
acagcagagagaggagaagaaatgacattttcctgcagggcctcaggctctccagaaccc
gccatctcctggttcaggaatggcaagctcattgaagaaaatgagaagtacatattgaaa
gggagcaatacagaactcactgtcaggaacataatcaatagtgatggtggtccttatgtc
tgcagggccacaaataaggcaggagaagatgaaaagcaagctttcctccaagtctttgta
cagcctcacataatacagcttaaaaatgaaactacatatgagaatggtcaagtcacactc
gtatgtgatgcggaaggggagcctattccagaaatcacttggaaaagagctgtggatggc
ttcacgttcactgaaggcgataagagcctggacggccgtatcgaagtcaaagggcagcat
ggaagctcatcactgcatattaaagatgtgaagttgtcagattcagggagatatgactgt
gaagctgcaagcagaattggagggcatcaaaagagcatgtaccttgatattgaatatgcc
cccaagtttatatcaaaccaaacaatttattactcttgggaaggaaatcctatcaatata
agttgtgatgtgaaatcgaatccaccagcatcaattcactggagaagagataaattagtc
ttacctgctaaaaacacgaccaatttaaagacttatagtacaggaagaaagatgatatta
gagattgcacctacatctgacaatgactttggacgctataattgcacagccactaatcat
ataggaacaagatttcaagaatatattcttgctttggctgacgtgccatccagtccctat
ggagtgaagatcatagagctgtcgcagaccacggccaaggtttccttcaacaaaccggac
tcccatggaggtgtacctattcatcactatcaggtggatgtcaaagaagtagcgtcagaa
atctggaaaattgtacgctcccatggagttcaaacaatggttgttttgaacaacctggaa
ccaaatacaacttatgaaatcagggttgcagctgtaaatggaaagggacaaggagactac
agtaaaatagaaatcttccaaacattaccagttcgtgaaccaagtcctccatccatacat
ggacagccaagcagtggaaagagctttaaactcagcatcaccaaacaggacgatggaggg
gcccctattttggaatacattgtgaaatatagaagtaaagataaggaagaccaatggcta
gagaaaaaagtgcaaggaaataaagaccacatcattttggagcatctccagtggaccatg
gggtatgaagttcagattacagctgccaatagattgggatattctgaaccgacagtttat
gaattcagcatgccaccaaagcccaacattattaaagacacgctgtttaatggtcttggg
cttggagcagtaattggcctgggagttgctgcactgctgctaattcttgtggtaacagac
gtcagctgcttctttattcggcaatgtgggttgctgatgtgcatcactaggagaatgtgt
ggaaagaaaagtggctccagtggcaaaagtaaagaactcgaagaaggaaaagctgcatac
ctgaaagatggatcaaaagaaccaatagtggagatgagaacagaggatgaaagagttact
aatcacgaagatgggagcccagtaaatgagccaaatgaaaccacaccactgacagaacct
gaaaaattgcctttaaaggaagaagatgggaaagaagctctaaatccagaaactatagaa
attaaagtttctaacgacatcattcaatcaaaagaagacgacagcaaagcataa

DBGET integrated database retrieval system