KEGG   Homo sapiens (human): 51552Help
Entry
51552             CDS       T01001                                 

Gene name
RAB14, FBP, RAB-14
Definition
(RefSeq) RAB14, member RAS oncogene family
  KO
K07881  Ras-related protein Rab-14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    51552 (RAB14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51552 (RAB14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51552 (RAB14)
   04031 GTP-binding proteins [BR:hsa04031]
    51552 (RAB14)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    51552 (RAB14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   51552 (RAB14)
  Exosomal proteins of other body fluids (saliva and urine)
   51552 (RAB14)
  Exosomal proteins of colorectal cancer cells
   51552 (RAB14)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    51552 (RAB14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA ATP_bind_1 SRPRB DUF1863 Septin AAA AAA_22
Motif
Other DBs
NCBI-GeneID: 51552
NCBI-ProteinID: NP_057406
OMIM: 612673
HGNC: 16524
Ensembl: ENSG00000119396
Vega: OTTHUMG00000020582
Pharos: P61106(Tbio)
UniProt: P61106 A0A024R845
Structure
PDB: 

Position
9q33.2
AA seq 215 aa AA seqDB search
MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKI
KLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVII
LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGS
LDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcaccatacaactactcttacatctttaaatatattattattggggacatg
ggagtaggaaaatcttgcttgcttcatcaatttacagaaaaaaaatttatggctgattgt
cctcacacaattggtgttgaatttggtacaagaataatcgaagttagtggccaaaaaata
aaactgcagatttgggatacggcaggacaggagcgatttagggctgttacacggagctac
tacagaggagctgcgggagctcttatggtctatgatatcactagaagaagtacatataac
cacttaagcagctggttgacagatgcaaggaatctcaccaatccaaatactgtaataatt
ctcataggaaataaagcagatttggaggcacagagagatgttacatatgaagaagccaaa
cagtttgctgaagaaaatggcttattgttcctcgaagcgagtgcaaaaacgggagagaat
gtagaagatgccttccttgaggctgccaagaaaatctatcagaacattcaggatggaagc
ttggatctgaatgctgctgagtctggtgtacaacacaaaccttcagccccgcagggaggc
cggctaaccagtgaaccccaaccccagagagaaggctgtggctgctag

DBGET integrated database retrieval system