KEGG   Homo sapiens (human): 5424
Entry
5424              CDS       T01001                                 

Symbol
POLD1, CDC2, CRCS10, MDPL, POLD
Name
(RefSeq) DNA polymerase delta 1, catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    5424 (POLD1)
   03410 Base excision repair
    5424 (POLD1)
   03420 Nucleotide excision repair
    5424 (POLD1)
   03430 Mismatch repair
    5424 (POLD1)
   03440 Homologous recombination
    5424 (POLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    5424 (POLD1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5424 (POLD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5424 (POLD1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    5424 (POLD1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      5424 (POLD1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     5424 (POLD1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Other DBs
NCBI-GeneID: 5424
NCBI-ProteinID: NP_001243778
OMIM: 174761
HGNC: 9175
Ensembl: ENSG00000062822
Vega: OTTHUMG00000183037
Pharos: P28340(Tclin)
UniProt: P28340 A0A024R4F4
Position
19q13.33
AA seq 1107 aa
MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQS
VLEGVADGQVPPSAIDPRWLRPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRG
SVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEHMGDLQRELNLAISRDSRGGR
ELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPP
EGPWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPC
APILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPF
LGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTG
VPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIAT
LDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRTPTGDEFVKTSVRKGLLPQIL
ENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAAD
WVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLV
ANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAH
VELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLS
HQGAVCEFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFY
MRKKVRKDLEDQEQLLRRFGPPGPEAW
NT seq 3324 nt   +upstreamnt  +downstreamnt
atggatggcaagcggcggccaggcccagggcccggggtgcccccaaagcgggcccgtggg
ggcctctgggatgatgatgatgcacctcggccatcccaattcgaggaggacctggcactg
atggaggagatggaggcagaacacaggctgcaggagcaggaggaggaggagctgcagtca
gtcctggagggggttgcagacgggcaggtcccaccatcagccatagatcctcgctggctt
cggcccacaccaccagcgctggacccccagacagagcccctcatcttccaacagttggag
attgaccattatgtgggcccagcgcagcctgtgcctggggggcccccaccatcccgcggc
tccgtgcctgtgctccgcgccttcggggtcaccgatgaggggttctctgtctgctgccac
atccacggcttcgctccctacttctacaccccagcgccccctggtttcgggcccgagcac
atgggtgacctgcaacgggagctgaacttggccatcagccgggacagtcgcggggggagg
gagctgactgggccggccgtgctggctgtggaactgtgctcccgagagagcatgtttggg
taccacgggcacggcccctccccgttcctgcgcatcaccgtggcgctgccgcgcctcgtg
gccccggcccgccgtctcctggaacagggcatccgtgtggcaggcctgggcacgcccagc
ttcgcgccctacgaggccaacgtcgactttgagatccggttcatggtggacacggacatc
gtcggctgcaactggctggagctcccagctgggaaatacgccctgaggctgaaggagaag
gctacgcagtgccagctggaggcggacgtgctgtggtctgacgtggtcagtcacccaccg
gaagggccatggcagcgcattgcgcccttgcgcgtgctcagcttcgatatcgagtgcgcc
ggccgcaaaggcatcttccctgagcctgagcgggaccctgtcatccagatctgctcgctg
ggcctgcgctggggggagccggagcccttcctacgcctggcgctcaccctgcggccctgt
gcccccatcctgggtgccaaggtgcagagctacgagaaggaggaggacctgctgcaggcc
tggtccaccttcatccgtatcatggaccccgacgtgatcaccggttacaacatccagaac
ttcgaccttccgtacctcatctctcgggcccagaccctcaaggtacaaacattccctttc
ctgggccgtgtggccggcctttgctccaacatccgggactcttcattccagtccaagcag
acgggccggcgggacaccaaggttgtcagcatggtgggccgcgtgcagatggacatgctg
caggtgctgctgcgggagtacaagctccgctcctacacgctcaatgccgtgagcttccac
ttcctgggcgagcagaaggaggacgtgcagcacagcatcatcaccgacctgcagaatggg
aacgaccagacccgccgccgcctggctgtgtactgcctgaaggatgcctacctgccactg
cggctgctggagcggctcatggtgctggtgaacgccgtggagatggcgagggtcactggc
gtgcccctcagctacctgctcagtcgtggccagcaggtcaaggtcgtatcccagctgttg
cggcaggccatgcacgaggggctgctgatgcccgtggtgaagtcagagggcggcgaggac
tacacgggagccactgtcatcgagcccctcaaagggtactacgacgtccccatcgccacc
ctggacttctcctcgctgtacccgtccatcatgatggcccacaacctgtgttacaccacg
ctccttcggcccgggactgcacagaaactgggcctgactgaggatcagttcatcaggacc
cccaccggggacgagtttgtgaagacctcagtgcggaaggggctgctgccccagatcctg
gagaacctgctcagtgcccggaagagggccaaggccgagctggccaaggagacagacccc
ctccggcgccaggtcctggatggacggcagctggcgctgaaggtgagcgccaactccgta
tacggcttcactggcgcccaggtgggcaagttgccgtgcctggagatctcacagagcgtc
acggggttcggacgtcagatgatcgagaaaaccaagcagctggtggagtctaagtacaca
gtggagaatggctacagcaccagtgccaaggtggtgtatggtgacactgactccgtcatg
tgccgattcggcgtgtcctcggtggctgaggcgatggccctggggcgggaggccgcggac
tgggtgtcaggtcacttcccgtcgcccatccggctggagtttgagaaggtctacttccca
tacctgcttatcagcaagaagcgctacgcgggcctgctcttctcctcccggcccgacgcc
cacgaccgcatggactgcaagggcctggaggccgtgcgcagggacaactgccccctcgtg
gccaacctggtcactgcctcactgcgccgcctgctcatcgaccgagaccctgagggcgcg
gtggctcacgcacaggacgtcatctcggacctgctgtgcaaccgcatcgatatctcccag
ctggtcatcaccaaggagctgacccgcgcggcctccgactatgccggcaagcaggcccac
gtggagctggccgagaggatgaggaagcgggaccccgggagtgcgcccagcctgggcgac
cgcgtcccctacgtgatcatcagtgccgccaagggtgtggccgcctacatgaagtcggag
gacccgctgttcgtgctggagcacagcctgcccattgacacgcagtactacctggagcag
cagctggccaagcccctcctgcgcatcttcgagcccatcctgggcgagggccgtgccgag
gctgtgctactgcggggggaccacacgcgctgcaagacggtgctcacgggcaaggtgggc
ggcctcctggccttcgccaaacgccgcaactgctgcattggctgccgcacagtgctcagc
caccagggagccgtgtgtgagttctgccagccccgggagtctgagctgtatcagaaggag
gtatcccatctgaatgccctggaggagcgcttctcgcgcctctggacgcagtgccagcgc
tgccagggcagcctgcacgaggacgtcatctgcaccagccgggactgccccatcttctac
atgcgcaagaaggtgcggaaggacctggaagaccaggagcagctcctgcggcgcttcgga
ccccctggacctgaggcctggtga

DBGET integrated database retrieval system