KEGG   Homo sapiens (human): 54734
Entry
54734             CDS       T01001                                 

Gene name
RAB39A, RAB39
Definition
(RefSeq) RAB39A, member RAS oncogene family
  KO
K07924  Ras-related protein Rab-39A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    54734 (RAB39A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    54734 (RAB39A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA Raptor_N
Other DBs
NCBI-GeneID: 54734
NCBI-ProteinID: NP_059986
HGNC: 16521
Ensembl: ENSG00000179331
Vega: OTTHUMG00000166367
Pharos: Q14964(Tdark)
UniProt: Q14964
Position
11q22.3
AA seq 217 aa
METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGK
RIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRI
VFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIK
KGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC
NT seq 654 nt   +upstreamnt  +downstreamnt
atggagaccatctggatctaccagttccgcctcatcgtgatcggggactccaccgtgggc
aagtcctgcctcctgcaccgcttcacccagggccgcttccccgggctgcgctcccccgcc
tgcgaccccaccgtcggcgtggacttcttctcccgcctgctggagatcgagccgggcaag
aggatcaagctacagctctgggacacggcgggacaggagcggttcagatcaataacccga
tcttattaccgcaactcagttggtggatttttagtatttgacattactaaccgacgatct
tttgaacatgtgaaagattggctagaagaagcaaaaatgtatgtacagccatttcggatt
gtatttctgctagtgggacataaatgtgatttagcttcacaacgtcaagttacaagggaa
gaagctgaaaaactgtcagcagactgtggaatgaagtatatagaaacctcagcaaaggat
gctacaaatgttgaagaatccttcacaatcttgacgagagacatatatgaacttattaaa
aagggagaaatttgtattcaggatggctgggaaggggttaaaagtggttttgttccaaat
actgtgcattcttctgaggaagcagtaaagcccaggaaagaatgcttctgctga

DBGET integrated database retrieval system