KEGG   Homo sapiens (human): 55207
Entry
55207             CDS       T01001                                 
Symbol
ARL8B, ARL10C, Gie1
Name
(RefSeq) ADP ribosylation factor like GTPase 8B
  KO
K07955  ADP-ribosylation factor-like protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01297  Arl8-regulated microtubule plus-end directed transport
N01300  Tethering of late endosomes and lysosomes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    55207 (ARL8B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55207 (ARL8B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    55207 (ARL8B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   Arf GTPases
    55207 (ARL8B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl8
    55207 (ARL8B)
SSDB
Motif
Pfam: Arf Ras Roc Gtr1_RagA G-alpha SRPRB MMR_HSR1
Other DBs
NCBI-GeneID: 55207
NCBI-ProteinID: NP_060654
OMIM: 616596
HGNC: 25564
Ensembl: ENSG00000134108
Pharos: Q9NVJ2(Tbio)
UniProt: Q9NVJ2
Structure
Position
3:5122292..5180911
AA seq 186 aa
MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKV
TKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL
QGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH
SKSRRS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgctggcgctcatctcccgcctgctggactggttccgttcgctcttctggaaggaagag
atggagctgacgctcgtggggctgcagtactcgggcaagaccaccttcgtcaatgtcatc
gcgtcaggtcaattcagtgaagatatgatacccacagtgggcttcaacatgaggaaggta
actaaaggtaacgtcacaataaagatctgggacataggaggacaaccccgatttcgaagc
atgtgggagcggtattgcagaggagtcaatgctattgtttacatgatagatgctgcagat
cgtgaaaagatagaagcttcccgaaatgagctacataatcttctagataaaccacagtta
caaggaattccagtgctagtgcttggaaacaagagagatcttcctaatgccttggatgag
aaacagctaattgaaaaaatgaatctgtctgctattcaggatagagaaatttgctgctat
tcaatttcttgcaaagaaaaggataatatagatatcacacttcagtggcttattcagcat
tcaaaatctagaagaagctga

DBGET integrated database retrieval system