KEGG   Homo sapiens (human): 5706Help
Entry
5706              CDS       T01001                                 

Gene name
PSMC6, SUG2, p42
Definition
(RefSeq) proteasome 26S subunit, ATPase 6
  KO
K03064  26S proteasome regulatory subunit T4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5706 (PSMC6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5706 (PSMC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5706 (PSMC6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5706 (PSMC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_2 AAA_22 RuvB_N AAA_18 Prot_ATP_OB_N AAA_33 AAA_7 DUF815 AAA_3 AAA_14 TsaE IstB_IS21 RNA_helicase TIP49 Mg_chelatase AAA_11 AAA_24 TPR_MLP1_2 ATPase NACHT AAA_25 GAS AAA_28 DUF4140 Med4
Motif
Other DBs
NCBI-GeneID: 5706
NCBI-ProteinID: NP_002797
OMIM: 602708
HGNC: 9553
Ensembl: ENSG00000100519
Vega: OTTHUMG00000152333
Pharos: P62333(Tbio)
UniProt: P62333 A0A087X2I1
Structure
PDB: 

Position
14q22.1
AA seq 389 aa AA seqDB search
MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctagagataaggcgcttcaggactaccgcaagaagttgcttgaacacaag
gagatcgacggccgtcttaaggagttaagggaacaattaaaagaacttaccaagcagtat
gaaaagtctgaaaatgatctgaaggccctacagagtgttgggcagatcgtgggtgaagtg
cttaaacagttaactgaagaaaaattcattgttaaagctaccaatggaccaagatatgtt
gtgggttgtcgtcgacagcttgacaaaagtaagctgaagccaggaacaagagttgctttg
gatatgactacactaactatcatgagatatttgccgagagaggtggatccactggtttat
aacatgtctcatgaggaccctgggaatgtttcttattctgagattggagggctatcagaa
cagatccgggaattaagagaggtgatagaattacctcttacaaacccagagttatttcag
cgtgtaggaataatacctccaaaaggctgtttgttatatggaccaccaggtacgggaaaa
acactcttggcacgagccgttgctagccagctggactgcaatttcttaaaggttgtatct
agttctattgtagacaagtacattggtgaaagtgctcgtttgatcagagaaatgtttaat
tatgctagagatcatcaaccatgcatcatttttatggatgaaatagatgctattggtggt
cgtcggttttctgagggtacttcagctgacagagagattcagagaacgttaatggagtta
ctgaatcaaatggatggatttgatactctgcatagagttaaaatgatcatggctacaaac
agaccagatacactggatcctgctttgctgcgtccaggaagattagatagaaaaatacat
attgatttgccaaatgaacaagcaagattagacatactgaaaatccatgcaggtcccatt
acaaagcatggtgaaatagattatgaagcaattgtgaagctttcggatggctttaatgga
gcagatctgagaaatgtttgtactgaagcaggtatgttcgcaattcgtgctgatcatgat
tttgtagtacaggaagacttcatgaaagcagtcagaaaagtggctgattctaagaagctg
gagtctaaattggactacaaacctgtgtaa

DBGET integrated database retrieval system