KEGG   Homo sapiens (human): 5706
Entry
5706              CDS       T01001                                 

Gene name
PSMC6, SUG2, p42
Definition
(RefSeq) proteasome 26S subunit, ATPase 6
  KO
K03064  26S proteasome regulatory subunit T4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5706 (PSMC6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5706 (PSMC6)
   05012 Parkinson disease
    5706 (PSMC6)
   05014 Amyotrophic lateral sclerosis
    5706 (PSMC6)
   05016 Huntington disease
    5706 (PSMC6)
   05017 Spinocerebellar ataxia
    5706 (PSMC6)
   05020 Prion disease
    5706 (PSMC6)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    5706 (PSMC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5706 (PSMC6)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     5706 (PSMC6)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_16 AAA_5 AAA_2 AAA_22 RuvB_N AAA_18 AAA_33 Prot_ATP_OB_N DUF815 AAA_7 AAA_14 AAA_3 RNA_helicase TIP49 IstB_IS21 Mg_chelatase TPR_MLP1_2 AAA_11 TsaE Wtap AAA_24 ATPase AAA_25 NACHT AAA_28 AAA_19 Med4
Other DBs
NCBI-GeneID: 5706
NCBI-ProteinID: NP_002797
OMIM: 602708
HGNC: 9553
Ensembl: ENSG00000100519
Vega: OTTHUMG00000152333
Pharos: P62333(Tbio)
UniProt: P62333 A0A087X2I1
Structure
PDB: 

Position
14q22.1
AA seq 389 aa
MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggaccctagagataaggcgcttcaggactaccgcaagaagttgcttgaacacaag
gagatcgacggccgtcttaaggagttaagggaacaattaaaagaacttaccaagcagtat
gaaaagtctgaaaatgatctgaaggccctacagagtgttgggcagatcgtgggtgaagtg
cttaaacagttaactgaagaaaaattcattgttaaagctaccaatggaccaagatatgtt
gtgggttgtcgtcgacagcttgacaaaagtaagctgaagccaggaacaagagttgctttg
gatatgactacactaactatcatgagatatttgccgagagaggtggatccactggtttat
aacatgtctcatgaggaccctgggaatgtttcttattctgagattggagggctatcagaa
cagatccgggaattaagagaggtgatagaattacctcttacaaacccagagttatttcag
cgtgtaggaataatacctccaaaaggctgtttgttatatggaccaccaggtacgggaaaa
acactcttggcacgagccgttgctagccagctggactgcaatttcttaaaggttgtatct
agttctattgtagacaagtacattggtgaaagtgctcgtttgatcagagaaatgtttaat
tatgctagagatcatcaaccatgcatcatttttatggatgaaatagatgctattggtggt
cgtcggttttctgagggtacttcagctgacagagagattcagagaacgttaatggagtta
ctgaatcaaatggatggatttgatactctgcatagagttaaaatgatcatggctacaaac
agaccagatacactggatcctgctttgctgcgtccaggaagattagatagaaaaatacat
attgatttgccaaatgaacaagcaagattagacatactgaaaatccatgcaggtcccatt
acaaagcatggtgaaatagattatgaagcaattgtgaagctttcggatggctttaatgga
gcagatctgagaaatgtttgtactgaagcaggtatgttcgcaattcgtgctgatcatgat
tttgtagtacaggaagacttcatgaaagcagtcagaaaagtggctgattctaagaagctg
gagtctaaattggactacaaacctgtgtaa

DBGET integrated database retrieval system